SNEADS TOWN COUNCIL REGULAR MEETING JUNE 13, 2023  The Town Council oft the Town of Sneads, Florida, met in a regular session at the Sneads Town  Hall on Tuesday, June 13, 2023, at 6:00 p.m.  Mike Weeks called the meeting to order with the following present: Mike Weeks, Tony Money, George Alexander, Angela Locke and Donovan Weeks, Council Members  Daniel Cox, Attorney Lee Garner, Town Manager Tyler Weeks, Police Chief Sherri Griffin, City Clerk Danielle Guy, Deputy Clerk And the following were absent: All stood for the Pledge of Allegiance. seconded. All voted aye. 1. Minutes for May 2023 3. Pay Approved Bills  None  Tony Money made a motion to approve the Consent Agenda as presented. George Alexander  2. Financial Statements and Budget Review Summary  President Weeks stated that the First Ladies of Sneads were present and wished to give an update on the recent fundraiser at Sneads Park. Kathy Leigh and Susan Durden informed Council the event was a success and another one is being planned. They asked about getting the stage the Town owns for future events. The Town Manager is to follow up on this request. They asked questions about the location ofa splash pad. A suggestion was made to put the splash pad near the Skate Park at the Recreation field off Legion Road. They were informed to contact the Town Agenda #4 and #5, Approve contract for sale and purchase of property at 1995 Gloster Ave and 1989 Gloster. Ave. Hunter Potts with Melvin Engineers, stated that we. have signed contracts from both property owners for the purchase oft the parcels for $30,000 each, which will be paid with the IIometown Revitalization grant funds. Town. Attorney stated we needed to insure that tille insurance and property taxes are paid upon the sale, sO that they could be tax exempt in the future. George. Alexander made ai motion to approve the contract for the sale and purchase of property at 1995 Gloster Ave. Donovan Weeks seconded. All voted aye. Donovan Weeks made a motion to approve the contract for sale and purchase of property at 1989 Gloster Ave. George Agenda #6, Advertisement for Bids for Lift Station #4 was discussed. The council was informed that there would be a pre-bid meeting June 29th and bids due/ opening July 18th.  Manager to go over further details about it.  Alexander seconded. All voted aye.    Regular Meeting June 13, 2023 Page2  Agenda # 7, Variance request from Tammy Jackson property owner at 2046 Lou Ave. (See attached) Ms. Jackson's property is short of the required size toj put a second mobile home and she is requesting a waiver. After discussion, Tony Money made a motion to grant the waiver to Tammy Jackson, allowing her to put a second mobile home, as long as she meets all other  requirements in the Ordinance. Donovan Weeks second. All voted aye.  Agenda # 8, Sneads Recreation Board. No report. Mr. Garner stated we need to look into hiring a Agenda #9, Town Manager Report as follows: (See attached) Mr. Garner informed Council that we had purchased a new mosquito sprayer, because ours was in bad condition. It cost $6,973 and has a dented gas tank, it is in a crate still and new condition, and we are saving $7,500. He also informed them about operational changes being made at the WWTP as ofJuly 1St, which should  Recreation Director.  save us money for maintenance, chemicals, and other improvements.  Agenda #10, Attorney Cox. No report  Police Department- Chief Weeks informed Council about personnel changes within the department. Brett Preston to Lieutenant, Maverick Haddock to Sergeant, and William Price to He stated he asked Pastor Juno Douglas to be the Department Chaplain. He is updating all the MOUS with various departments in the area to ensure continued cooperation and support as needed. He reported on the number of arrests and cases the office has completed since his Fire Department- Russell McAlpin informed Council that the department is going through their annual fire inspection. He stated that the newest fire truck passed, however the oldest truck Both the Police and Fire Departments visited the Sneads Methodist Church during Bible School and made presentations to our youth, and we are proud of them for doing such events throughout Agenda #11, Council Members. Donovan Weeks stated we needed to find a way in the budget for the Recreation Director position as he was pleased with progress over the last couple ofyears and did not want any programs reduced. Mike Weeks stated we were getting more trashy properties in the Town and asked that priority be given to looking into these matters. The Town Manager reported he had submitted three (3) letters this week and would make a special effort to do more soon. Mike Weeks also stated that the annual Florida League of Cities annual conference would be held on August 12-14 in Orlando and requested authorization for him and the Town Manager to attend. Donovan Weeks made a motion to approve the travel request.  Full time Officer.  appointment and this will be a monthly report in the future.  failed. They are working on getting it in passing order.  the Town.  George Alexander seconded. All voted aye. Agenda #14, Public Comments: None.    Regular Meeting June 13, 2023 Page 3  Donovan Weeks made ai motion to adjourn at 6:41 pm.  Respectfully Submitted, Danulu Danielle Guy, Deputy  Guy  APPROVED:  MIKE WEEKS, COUNCIL PRESIDENT    Regular Meeting JUNE13, 2023  Budget Summary GENERALFUND GASTAX amount. SOLID WASTE amount.  MAY- Revenues are 8.74% below budgeted amount. Expenditures are 9.26% above budgeted amount. MAY- Gas Tax County is 6.36% above budgeted amount. Local Option Gas Tax is 1.66% above  budgeted  Expenditures are in line with budgeted amount.  MAY- Garbage revenues are 3.56% above budgeted amount. Expenditures are in line with  budgeted  WATER AND SEWER-ACI Seweri is 5.84% below budgeted amount. Water Sales and Sewer Sales are in  line with budgeted amount. Expenditures are 3.96% above budgeted amount.  RECREATION FUND  MAY- Revenues are above budgeted amount. Expenditures are: slightly above budgeted amount.    CONTRACT FOR SALE AND PURCHASE  PARTIES: Jason & Nikisha L. Milsap Post Office Box 159, Sneads, FL: 32460  ("Seller")  of  1989 Gloster Avenue. Sneads. FL32460  (Phone,850-573-156  and  Town of Sneads. Florida, a municipal subdivision oft the State of Florida (Buyer") of  Phone)850-593-6636 hereby agree that the  Seller shall sell and the Buyer shall buy the following described real property (Real Property") and personal property ("Personal Propeny)(collectively called the "Property"). upon the following terms and conditions, which include the General Contract Provisions attached hereto, and any Riders and/or Addenda tot this  contract.  1. DESCRIPTION:  (a) Legal description of Real Property: STORE AN LOTS ON WEST SIDE OF GLOSTER AVENUE. NORTH OF LOUISVILLE & NASHVILLE RAILROAD. SECTION 34. TOWNSHIP 4 NORTH. RANGE 7 WEST. LYING AND BEING IN JACKSON COUNTY,  FLORIDA.  (b) Street Address: 1989 Gloster Avenue (c) Tax Parcel #: 4N-07-000.0390.000  (d) Personal Property: All fixtures attached to the Real Property  2. PURCHASE PRICE: Payment:   30,000.00 $ -0- $ N/A $  (a) Deposit(s) to be held in escrow by  (b) Additional deposit within days after Effective Date in the amount of. $ N/A (d) Purchase money note and mortgage (See Paragraph 4 (a))i in the amountof.. $ N/A () Balance to close (local cashier's check), subject to adjustments and prorations $30.000.00 3. FACSIMILE, EFFECTIVE DATE: A facsimile copy of this Contract for Sale and Purchase ("Contract") and any signatures hereon, shall be considered for all purposes as originals. The date of Contract ("Effective Date") will be the date when the last one oft the parties has signed this offer.  (c) Subject to an assumption of mortgage in good standing held by  Loan No.  (e) Other:  4. FINANCING: Purchase Money Mortgage Third Party Financing  Mortgage Assumption  Cash  PPseMAMyMereN Interest! Rate: rAmertization-Tem: YFS.Balleen: ys Phepurehase-meneymeteamemergeghl-powidelorra30-day-graee: pere-P-e-eventet eaulifelistmertsgamdalsdaysgeperiedifassederisermeshal-previde orrightotprepaymenHRwAeleeFiRpPaw#heuEPemaywayPePeymeNtaPPymgte nteres-and-the-e-P-pinep-ami-e-apsmen-in-ege.ty-sehasu-peyments-en-parial PepymeNsgmissegealepweeemsaiesiaseluies HeprierwEteReRsesemtefselehaskeenetaRwaAsesmarAeecemditiemeupen pwseFHeemstwesN-pepaaitaaemsrsméw WFliencentmmatiomefwyer-hwyerwyerwinetberessaySywe nless-agreed-R-wEitiwritimgtyselershalreginealpierhemsamdemsumbannseste-bekep-n seedstanding-and-eretdmwlifivatissFvruure-aranscrumderPHeFmergag-amdhe mergage-moieamdseysgeeisNin-ommaméemetreurebySeller:    selermayamyrpireedayk.eesse,amiswuriy SSeYeNwN byintiwiomaHemts-iasases-i#-he-cany hweieRaPepeywpy-hora-igat Selefsepiaa-heatawewlyrwniel Panyimmig-mtheae-aingwiA Me-aN-tem-asspiahe-yPyessale-disertion yahthees eiCateamsAinewHptayNselerwrlieaie cFermimatiem-erfailsulaele-finameing-within PeFEHReMCDMeLPe emmnamen-Pufsuanevisenpate-ha-be-release-t Initials b-gtions-hereundep-exeep-8-e-mae-wAe-ewpressy-survive-tn Comtraet-Buyes-aimeygwenstiseaftemintinwashaowmsiNeavavereftherigh e-Mertgage-Assumpten-PHs-Contraetiscentingentuper-Buyerbeingablee-sRtume-the-ekisting mertgage PRPeNEREtemNS4RA-ceRdReNS-eF dt-an-interestaie-mette-exeeed: mdise-metgegsechargeehgsnetoewels Wheh-charges-shal-be-paid-by. Seller-or Buyer. Bwyet-shalWhR- days-efHe-EResive-a-sgeaNtmF-make-i-ReEsay Ppheatten,"eudig-e-Payment-eFaregHret-aPPheate#-ane-oar-assumpmen-fees,te-the lender-lF-Bwyeris-metapprove-by-lender-within: DAYS-OFTHE-BHeetive-Date,0rifthe equrements-eFtheFtheassumptemaremotimaeceordance-witHtneiemseFINS-CORtFRet,eriflender harges-P-ekeess-eseftne-agredameumt-her-Buyermay-eketeieerinatethisceRtFaeEDy-gHVing Fier-eliee-e-Selerwihsaidme-brppovakaméreesrefméoraepositspaid. unlesss AEeRRENN busines-daysaferrerrspeefbwyes--molice-te-pey-the Rerease-#-mteres-ate-ant-exes-eharges-Bwyers-eHree-tmeygive-metiee-ee-OFePHAtOR  naneingstatements.  leminatehereunder.  halkenstiuieawaiveflerhPiemminse-hereunder:  5. TITLE INSURANCE: Seller, at Seller's expense, shall deliver to Buyer or Buyer'sa attorney, or K Buyer, at Buyer's expense, shall obtain, within 30 days of the Effective Date, a title insurance commitment, with the premium for the owner's S policy to be issued at closing tol be paid by - Seller K Buyer. The title insurance commitment shall bei issued by al Florida licensed title insurer agreeing toi issue to Buyer, uponi recording of the deed tol Buyer, the owner's policy oftitle nummcinlieamoumtoniepunchuepischnsung Buyer'stitleto the Real Property. subject only tol liens, encumbrances, exceptions or qualifications: set forthi ini this Contract. and those which shall bedischarged by Selleratorbeforeclosing. Selerahalcomeymancahet titlesubject only to. liens, encumbrances, exceptions or qualifications specified in the Contract. Marketable title shall be determined according to applicable Title standards adopted by authority ofthe Florida Bar and in accordance with law. Buyer shall have 7 days from date of receiving the title commitment to examineit. Iftitle is found unmarketable ornotinc compliance with this Contract, Buyershall within said 7 days, notify Seller in writing specifying defect(s). Ifthe defect(s) render title unmarketable, Seller will have 60 days from receipt of notice within which to remove the defect(s), failing which Buyer shall have the option of either accepting the title as it then is, or demanding a refund of deposit(s) paid which shall immediately be returned to Buyer, and this Contract, andtherights: sand obligations of the parties hereunder, shall terminate, except those which expressly survive the termination ofthis Contract. Seller shall,iftitleisf found unmarketable, use diligent effort to correct defect(s) in the title within the time provided therefrom, but not including the institution of any 6. SURVEY: Seller, at Seller's expense,orl Buyer, at Buyer's expense, within timeallowed to deliver evidence of title and to examine same, shall or Kmay have Real Property surveyed and certified  suit or proceeding.    by a registered Florida surveyor. If survey shows encroachment on Real Property, or that improvements located on Real Property encroach on setback lines, easements, lands ofothers or violate any restrictions, Contract covenants or applicable governmental regulation, thes same shall 7. CLOSING: This transaction shall be closed, the deed, other closing papers and possession delivered, and thel balance ofthe purchase price paid on orbefore the earlier of10d days from receipt offunding for the Hometown Revitalization Grant previously: awarded tot thel Buyer or6 60 days after thel EffectiveDate. unless extended by other provisions ofthis Contract. Closing shall bel heldi int the county in which the Real Propertyislocated: at the office ofan attorney ortitleagencyd designated by Seller. Unless otherwise: agreed, closing shall take place between the hours of 8:00 a.m. and 6:00 8. CONVEYANCE; TITLE, RESTRICTIONS AND USE: Seller shall convey the Real Property by SPECIAL WARRANTY DEED, unless otherwise provided, subject to: (i)zoning, restrictions, prohibitions and other limitations imposed by governmental authority; (ii) restrictions and matters appearing on the plat or common to the subdivision; (iri) public utility easements of record; provided the same are located contiguous tothel Real Property lines, not moret than 101 feetin width astotherearorfontine: and7.51 feet in width as to the side lines, unless otherwise provided herein; (iv) taxes for the year of closing and subsequent years; (v) any purchase money mortgage or mortgage(s) to be assumed; and (vi) such other matters as are approved by Buyer or set forth in a Permitted Exceptions Addendum, ifattached hereto, provided none ofthe foregoing shall prevent the use of the Real Property for commercial purposes. Personal Pgprtysiallecomeyadby, anabsolute BillofSale, free and clear ofall liens, unless otherwise provided herein.  constitute at title defect.  p.m., and not on a Saturday, Sunday, or national holiday.  Initials  9. - CONDITION AND SUITABILITY OF PROPERTY: K As Is  (a) B As Is: The property is being sold "AS IS." Buyer shall have a30 calendar day period ("Inspection Period") from the Effective Date, in which the Buyer, or his designated Agent(s) will be allowed to enter onto the Property, at reasonable times and with prior notice to Seller, to perform inspections andi tests asl Pyasincsyudms inl Buyer'ssolediseretion, that thel Property is suitable for Buyer'si intended use, including but not limited to, surveys, soilborings, environmental audits, termite and wood destroying organisms, HVAC, mechanical, plumbing, electrical, roofand structural. Such inspections or tests shall be made at Buyer's sole expense. Buyer shall be responsible for any damages caused bysuchtestsorinpections sandshallindemnify andholdSelerhamles: fomanydmageorinwy ppappaymcmctn withanysuch inspection or test. Should Buyer notify Seller or Seller's agent in writing prior tot the expiration of the Inspection Period that the Property is not suitable, in Buyer's sole discretion, all deposits shall berefunded tol Buyer, and this Contract, andi therights and obligations oft the parties shall terminate, except as to matters which expressly survive the termination of the Contract. Buyer's failure to timely give notice of termination shall constitute a waiver oft the right to terminate hereunder. 6b) Gea-Wenking-Onder: Saleremes-N-eseeling-wftmeang the-faseia-and sefisk-esterierand-ierierwall.dems-hawesnyvsibieevdenceofas--waerdamage-er RetRamee-améalehanse-ems, stig-ig-sirekeplumbEpsens mamahinyramsalieppiane-hnatwutwwtigi-a-magyshalanstsuniet lasingeFHEceRet-bwyeshal-hawe, wmlrdyatintipesiwiwP)dw ERetiveDate-inwhiehieBwyererBayefisdeigmieisemsalFondCesisero: eréhitetwillbe-alloedemersmi-ie-Prperyatrew-timsemiwat-priormotivee Salieriepufemmsahiseptw--rtwsayriiedatemineisraliet    ematiewaeiwgas:swaa-Swe pestomseriesishalsemaeatBwyes-seleempense- Bayershal-be-respespensibie-er-any? Aamgessaltysaahiwsiaw ydimgestimeyiepeV.nSeNSyet hilam-selerinwnlineiwefhelapstPawrinpfemyseistsinitem: wememial-lFrphawemeiswNewh-tesametolemadeiw wingany-ie-megwwseerwkss ityekealFiwdteis Ifthe-cests FsehwphsemeN-gtwwwedarsalererrPwy-rypey-tN miaiiagiedaseCyegwtsiseNe eahwr.tpmteminatiampA.eremiadae-hyesand epamie-hilereisawawaglmiaps-Pm.e whshepsyswvivese.GwwtweiPimeySMemeNsee deelsslalicnsiseansiRathpywpatyamie-waveroflie e/Mainemanse-Beiwem-he-EPeivet Date and-the-date-ofeiesing-eweep-ferrepairs-required EPPeSPA Seliershwilr-mainai-Pwpy-iwing-enstimieto-rw mechaice-syste-s-eleinealsystes, plembingsysiems-andHeHMACsysems-thelawmand mihwy-la-le-same-esraiNgwDa-mdny-wer-am-wr O-PERMIFTING: Buyersha-naves: ardyratehemiwPwww EPeihepae-e-dsminMgnwuse FAesavtpperyamdaweseunssmineet herrepainigewesenelopmemiotls Pwpervy-CiypCaumyan SuateefFlwileentiaeme-ieaeww-iEisaiselamese-engs permitting ewie---ee sssslowhaher:-bPwpyas. llydaringiePemitinenkawwwinwthga esF-Fwpanyaml-taydsesasaly PayesimahilyoRe-ePpyis-swehediinein Baye-sele-disertieon-the-regre gevermmentar - reasenabletime-rampense-bayersha-Rely Seterer SeHers-agentR-WEIS-PHerte the PF-Pe Period, andall depesits-shall-be-relimdet-e-Bwyet Upon termnation pursuant-to-ths prevision, pewiatwe-awwe igatis-aereund#:NeNP-e-P-mNE Wheh-express: e-.EN Cwina-Payer-lilweietww-swse  He'emaneheeunie.  excepted.  eiemmimateheeunde:  Initials  H-WOOD-DESFROVING-ORGANISMS-FHe-Re" Property-S-ROt-Bemspwrvm PMnMB-PaREPe-hngbyt.a Bwyer's-expense," MA--mPNeP pET95-c-G-t wA-yw-- iwae---hyww Suaysem-daeefsirp-iiwhaewhaalicerastmpsisd mksinamsalyslkemsawaMagwiwwwseyeaiksofrsmaet amdrepairefal-damageuptes ShesidsuehestseweecNFeeRRe pwylesae-e-iyerwwifwsCamtwwiasdysalerwer    Femiraeefsmepairestimatebygingt "assaltyeyewP wiheassiw-iwhwatdaeammiegute 12. HAZARDOUS SUBSTANCE: Seller represents that Seller has no knowledge of any toxic, petroleum, asbestos orhazardous substances being stored, used or otherwiser released ont the subject Property. Buyer acknowledges that Buyer has the ability to audit the subject Property during the herein described Inspection Period and to terminate this Contract and receive a refund of all deposits in the event any are found and Seller is not willing to pay the costs of removal or remediation. BuyermayleminatetneContractbygving awHeew tothee expiration ofthel Inspection Period. Buyer'ssoleremedy for such contaminates found on site shall be the termination of the Contract and return of any deposits, unless Seller has herein 13. RADON GAS: Radon is a naturally occurring radioactive gas that, when it has accumulated in a building ins sufficient quantities, may present health risks toj persons who are exposed toitovertime. Levels ofradon that exceed federal and state guidelines have been found in buildings in Florida. Additional information regarding radon and radon testing may be obtained from your county public 14. BLEDINGENERGKEFRICIENCK-PaRseSauanssas94,amasus-bwyerme-havetne eg-4HhameyrsheanErenemiaai Buyer-aekmewiedges-Fecept-oF-he  wofhe-esanesesefsadament  misrepresented Seller's knowledge of thesame.  health unit.  Ferida-BudingEne/-EFReee/RaNtatingSse-momien-Breehure. -AMEERICANS-DISABEIESACTE Athe  ak  HlwAHe-diseRinse  gains-pepie-ili-diamyaisealmpomiyePeis-H equal-aeeess-and services-te- disablee-RdAdHaser-aEHa neither SEBAN-my PresHeRaEe-WAwH-sEPePeygenism--ne: AD-A-amdshal-imdemaiyamd-mod Seller-ami-Breket-hamiesinheevmlepepeydMsMEBNti-Thi-previsiemshal 16. LEASES: Sellerwarrant'st thati therearenol leases in effect forthep property except as disclosed in 17. EXCHANGE: Buyer and Seller agree to cooperate with each other in completing a 1031 Tax Free Exchange under the Internal Revenue Code by arranging closing to qualify for such exchange and by completing such additional documentation as may be reasonably necessary to accomplish the same; provided, however, the partner desiring the exchange shall be obligated to assume all liability or cost associated with such exchange. The party not desiring the exchange shall not be required to purchase an exchange parcel, nor shall theterms ofthis Contract, including the date ofclosing, ber modified as ai result of compliance with the terms of 18. INGRESSANDEGRESS:Sellerwarrants andi represents thatt thereislegal ingress ande egresst stothe 19. LIENS: Seller shall furnish to Buyer, at time of closing, an affidavit attesting to the absence, unless otherwise provided for herein, of any financing statements, claims of lien or potential lienors known to Seller and further attesting that there have been no improvements or repairs to the Property for 90 days immediately preceding date ofclosing. If Property has been improved or repaired within that time, Seller shall deliver releases or waivers ofmechanics' liens executed by all general contractors, subcontractors, suppliers and materialmen in addition to Seller's lien  suvive-theelesing  theLease Addendum attached to this Contract.  this provision.  Real Property, title to which is in accordance with paragraph 5 ofthis Contract.    affidavit setting forth the names of all such general contractors, subcontractors, suppliers and materialmen and further affirming that all charges fori improvements or repairs which could serve as a basis for a mechanic's lien or a claim for damages have been paid or will be paid at closing of  this Contract.  Initials    20. TIME: Time periods herein of less than 3 days shall in the computation exclude Saturdays, Sundays and state or national legal holidays, and any time period provided for herein which shall end on Saturday, Sunday or a legal holiday shall extend to 5:00 p.m. ofthe next business day. 21. DOCUMENTS FOR CLOSING: Seller shall furnish the deed, bill of sale, mechanic's lien affidavit, assignment ofleases, tenant and mortgagee estoppel letter, corrective instruments, and 22. EXPENSES: Seller acknowledges and agrees that the Buyer is exempt from payment of documentary stamps ont the deed and as such, Seller shall payall documentary stamps and thec costs ofrecordingofany corrective instruments. Recording fees to record the deed, any purchase money 23. PRORATIONS, CREDITS: Taxes, assessments, rent, interest, insurance and other expenses and revenue oft the Real Property shall be prorated through day before closing. Cash at closing shall be increased or decreased as may be required by prorations. Prorations will be made through the day prior to closing, unless otherwise provided herein or agreed in writing. Advance rent and security deposits will be credited to Buyer, and escrow deposits held by the mortgagee of a mortgage to be assumed will be credited to Seller. Taxes shall be prorated based on the current year's tax with due allowance made for maximum allowable discount, and other exemptions. Ifclosing occurs at a date when the current year's millage is not fixed and current year's assessment is available, taxes will be prorated based upon such assessment and the prior year's millage. If current year's assessment is notavailable, then taxes will be prorated on the prior year'sta tax. Iftherearecompleted improvements on the Real Property by January 1st of the year of closing, which improvements were not in existence on January Ist of the prior year, then taxes shall be prorated based upon the prior year's millage and at an equitable assessment to be agreed upon between the parties, failing which, request will be made to the County Property Appraiser for an informal assessment, taking into consideration available exemptions. Any tax proration based on an estimate shall, at request of either Buyer or Seller, be subsequently readjusted upon receipt of tax bill on condition that a 24. SPECIALASSESSMENTLIENS: Certified, confirmedandratified. special assessment liensa as of dateofclosing (not as ofEffective Date) are to bej paid by Seller. Pending liens as ofdate ofclosing shall be assumedbyl Buyer. Iftheimprovement. hasbemsuibtamtalycomplycomplatdasofestivel Date, suchpending lien shall be considered certified, confirmed or ratified and Seller shall, at closing, be charged an amount equal to thel last estimate ofassessment fortheimprovement by the public body. 25. RISK OF LOSS: If the Property is damaged by fire or other casually before closing, and the cost of restoration does not exceed 3% of the assessed valuation of the Property SO damaged, cost of restoration shallbeanobligation ofthe Seller and closing shall proceedinaccordance: witht theterms ofContract with restoration costs escrowed at closing. Ifthe cost ofrestoration exceeds 3% oft the assessed valuation oft the improvements SO damaged, Buyer shall have the option of either taking Property as is, together with either the 3% or any insurance proceeds payable by virtue ofs such loss 26. ESCROW: Any escrow agent ("Agent") receiving funds or equivalent is authorized and agrees by acceptance of them to deposit them promptly, hold same in escrow, and, subject to clearance, disbursethem in accordance with terms and conditions of Contract. Failure of clearance of funds, shall not excuse Buyer's performance. Ifin doubt as to Agent's duties or liabilities under the provisions of Contract, Agent may, at Agent's option, continue to hold the subject matter of the  closingstatement. Buyer shall furnish all third party loan documents.  mortgage and any financing statements shall be paid by Buyer.  statement to that effect is in the closing statement.  or damage, oro ofcanceling this Contract and receiving return of deposit(s).    escrow until the parties mutually agree to its disbursement or until a judgment of a court of competent jurisdiction shall determine the rights of the parties or Agent may deposit same with the clerk ofthe circuit court havingjurisdiction ofthe dispute. Uponi notifying all parties concerned of such action, all liability on the part of Agent shall fully terminate, except to the extent of accounting for any items previously delivered out ofescrow. Ifalicensed real estate broker, Agent will comply with provisions ofChapter 475, Florida Statutes, as amended. Any suit between Buyer and Seller wherein Agent is made a party because of acting as Agent hereunder, or in any suit wherein Agent interpleads the subject matter of the escrow, Agent shall, unless found to have defaulted under Agemfisspwamdorstwup, asmeneriwceAN feesandcosts incurred with the fees and costs to be paid from and out of the escrowed funds or equivalent, or reduced to. judgment ifs said escrow funds are not available or are insufficient to pay the award. Parties agree that Agent shall not be liablet to any party or person forr misdelivery tol BuyerorSeller ofitems subject toi this escrow, unless such misdelivery is due to willful breach of this Contract or  gross negligence of Agent.  Initials  27. ATTORNEY'S FEES, COSTS: In connection with any litigation arising out of or instituted for the purpose of enforcing this Contract, the prevailing party in such litigation shall be entitled to recover reasonable attorney's fees and costs. For the purposes of this General Provision, Seller, Buyer, listing broker, selling! broker, buyer's! broker, and anysubagents ofthes same shalll bee eligible 28. FAILURE OF PERFORMANCE: Iffor any reason other than a failure oft title or breach ofany covenant to be performed or met by Seller, Buyer fails to close, the Seller's sole remedy shall be tot terminate this contract. In the event ofa default be! Seller, Buyer shalll havethe option ofany and all remedies afforded under the laws ofthe State of Florida, at law ori in equity, including the right 29. CONDEMNATION: If, priort to the closing hereof, all or any portion ofthe Real Property is taken by eminent domain or isi the subject of a pending taking which has not been consummated (hereinafter collectively referred to asa"Taking"), Seller shall give Buyer written notice ofsuch, and Buyer shall have the option to either (i) terminate this agreement, or (ii) proceed with the closing in accordance with the terms of this Contract. Buyer's written election shall be delivered tos Seller not later than 15 days after receipt of written notice from Seller, but in any event prior to closing. Ifthis agreement is terminated as aforesaid, neither party shall have any further rights or obligations tot the other hereunder, except for any matters whichs specificallys survive termination of this agreement. If Buyer does not elect to terminate this agreement as aforesaid, Seller agrees to assign tol Buyer, at closing, all sums which are to be awarded for the Taking and give credit forany deposits or payments already received by Seller, Buyer shall thereafter be entitled to receive and 30. CONTRACT NOT RECORDABLE, PERSONS BOUND, NOTICE: Neither this Contract, nor any notice ofit, shall bei recorded ina any publici records. This Contract shall bind andinuret tot the benefit oft the parties and theirs successors ini interest. Whenever the context permits, singular shall includeplural andone gender shall include all. Notice givenbyortotheatomey for any party shall 31. OTHERAGREEMENTS: Nopriororpresent: agreements orrepresentations: shallbebindingi upon Buyer or Seller unless included in this Contract. No modification or change in this Contract shall be valid or binding upon the parties unless in writing and executed by the party or parties intended  parties.  tos specificp performance.  keep any award for such Taking by eminent domain.  be as effective asi ifgiven! by or to that party.    tob bel bound byit.  32. BROKERS: Buyer and Seller represent to each other that neither have dealt with an undisclosed Broker in connection with this transaction, and that no commission is due from Seller or Buyer to any person except as agreed in writing by the party sought to be charged with such commission, except as  follows: (a) Broker: (specify): (b) Broker: (specify):  N/A  who  Isa an agent of SELLER, or BUYER, or isa Transactional Broker, and who will be  compensated by SELLER, or J BUYER, or  both parties pursuant to a listing agreement or other  N/A  who  Is an agent of SELLER, or - BUYER, or is a Transactional Broker, and who will be  compensated by J SELLER, or D BUYER, or  both parties pursuant to a listing agreement or other  (c) Indemnification ofl Broker: In connection with any act relating to the property, including, but not limited to, inquiries, introductions, consultations and negotiations resulting in this transaction, Seller and Buyer agree toi indemnify and hold harmless any Broker identified herein from and against losses, damages, costs and expenses, including reasonable attorney's fees, and from liability to any person arising from (i) compensation claimed which is inconsistent with the representation in this Paragraph, (ii) any duty accepted by broker at the request of Seller or Buyer, which duty is beyond the scope of services regulated by Chapter 475, Florida Statutes, as amended from time to time, or (iri) the recommendation of or services provided and expenses incurred by any third party whom broker refers, (d) Attorney's Fees: In connection with any proceeding between any broker identified ini this contract and Seller or Buyer to collect a brokerage fee pursuant to this Contract, the prevailing party shall be rtHymtr- ------ ishne-iww-w.wsww yaiysamwweA e-Seller-fFWhe-FassashaiasecNetelesebeaiseoFte elsalerialareefseleseleriepefmselershapye: FetebekereRPemaN. (f) Indemnification of Buyer: Seller agrees to indemnify and hold Buyer har Initials losses, damages, claims, costs and expenses, including reasonable attorney's rees, and Irom l1ability toa any person arising from compensation claimed which is inconsistent with the representations in this  recommends or retains for or on behalfo of Buyer or Seller.  entitled to: recover the costs thereof, including reasonable attorney's fees.  Contract.  33. TIME OF ESSENCE: TIME IS OF THE ESSENCE INTHIS AGREEMENT. and shall not be construed to alter or amend any provision oft this agreement.  34. HEADINGS: The headings on each paragraph and subparagraph are for the convenienceofthe, parties 35. NOTICE AND ADDRESSES: Any notice required or provided for under this agreement shall be effective upon receipt by the addressee, upon hand delivery during regular business hours or mailed by certified mail, return receipt requested, express or similar receipted delivery, or confirmed 36. GOVERNING LAW AND VENUE: This agreement shall be construed in accordance with the laws of the State of Florida. The venue of any litigation arising out of or instituted for the purpose of  facsimile.    enforcing this Contract shall bei in the county in which the Real Property is located. 37. ASSIGNABILITY: Buyer may assign or may not assign this Contract or any rights 38. ADDENDUM: There is or - is not an Addendum attached to this Contract. 39. LICENSE DISCLOSURE: - Seller Buyer discloses that said party is a licensed real estate #PACREAGEPRICEADIUSTNEMTaa--swyyashyaFiaia. iSngetanP-eeegrrian aeres,themin-that 41. OTHER PROVISIONS: The closing oft this Contract is contingent upon funding for the CDBG-  hereunder to an affiliated entity.  broker.  vemtthepurehsepiseaaleaereterefetepriseefs;  Hometown Revitalization Grant that Buyer has previously been approved for.  THIS IS INTENDED TOI BE. A LEGALLY BINDING CONTRACT. IF NOT FULLYU UNDERSIOOD, SEEKTHE  ADVICE OF AN ATTORNEY PRIOR TO SIGNING.  (BUYER) Date  (SELLER) Date  Social Security or Tax ID#  Social Security or Tax ID#    CONTRACT FOR: SALE AND PURCHASE  PARTIES: Phillip L. Fern  ("Seller") Phone)850-742-3395. and  of  1995 Gloster Avenue. Sneads. FL 32460  Town of Sneads, Florida, a municipal subdivision oft the State of Florida (Buyer")of  Post Office Box 159, Sneads, FL 32460  Phone)850-593-66.6 hereby agreet that the  Seller shall sell and thel Buyer shall buyt the following described real property (Real Property") and personal property ("Personal Propeny'(collectively called the "Property"). upon the following terms and conditions, which include the General Contract Provisions attached hereto, and any Riders and/or Addenda tot this  contract.  1. DESCRIPTION:  (a) Legal description of Real Property: Parcel 1: Beginning at a point 8 feet South of the original SE corner oft the Hattie Pope lot ofthe Town of Sneads, Florida, thence Easterly 25 feet to the center line of Gloster Avenue, thence Southerly down the center line of said Avenue 62 feet, thence Westerly 111 feet to an iron pipe, thence North 16% degrees West, 62 feet to an iron pipe, thence Easterlyi in a straight line to the Point of Beginning, less and excepting a lot 19 feet 6inches wide. North and South, across the entire North side. It is the intention of this deed to convey a certain store loti in the said Town of Sneads. Florida, commonly known as the Pender Store lot on the West side of Gloster Avenue. being a part of the NW % of NW % of Section 34. Township 4 North, Parcel 2: Commence at the section line between Sections 34 and 27. Township 4 North. Range 7 West, Jackson County, Florida, intersects to the West right of way line of Gloster Avenue. thence S13032'E, along the West right of way line ofGloster Avenue. 28.0 feet to the Point of Beginning, thence continue S 13°32'E, along the West right ofway line ofGloster Avenue, 46.67 feet, thence $7731-W.85.67 feet., thence N13932-W.46.11 feet, thence N 76°28'E,85.67 feet to the Point of Beginning, lying and being in the NW %4 of Section 34. Township 41 North. Range 7 West. in the  Range 7 West, Jackson County. Florida.  Town of Sneads. Jackson County, Florida. (b) Street Address: 1995 Gloster Avenue (c) Tax Parcel #: #4N-0/-000-02e000  (d) Personal Property: All fixtures attached to the Real Property  2. PURCHASE PRICE: Payment:  $ 30.000.00 $ -0- $ N/A $  (a) Deposit(s) to be held in escrow by  (b) Additional deposit within days after Effective Date in the amount of.  $ N/A (d) Purchase money note and mortgage (See Paragraph 4 (a))in the amountof.. $_ N/A (f) Balance to close (local cashier's check), subject to adjustmentsand prorations $30.000.00 3. FACSIMILE, EFFECTIVE DATE: A facsimile copy of this Contract for Sale and Purchase ("Contract") and any signatures hereon, shall be considered for all purposes as originals. The date of Contract ("Effective Date") will be the date when the last one ofthe parties has signed this offer.  (c) Subject to an assumption ofmortgage in good standing held by  Loan No.  (e) Other:  4. FINANCING: L- Purchase Money Mortgage Third Party Financing  Mortgage Assumption  Cash    -Purehase-Meney-Mrtgage-inierest Rate: -Amertization-femm yS.-Balleon: hepaahasemaeyNe-rasyPweraiaieswm-at afatimmerEsg-weatwiwlwrawae rAghtofprepaymentinwhvleerimput-whupemiywHhayPePaymeNentapplyimg-fiste esta-wtepid-a-pymas-m-pania prepaymenis,tmlessagreadinwlingeyleheleshatpovdelora-dweossalieelise-"unies ePHF-WHeR-cOnsentefselerha-beem-ebaineet-améwhehcensemtmeybecenecenditienedupen pwaiafleemltweri--aaraméNw WFeECORFmAtReEBwyerthatBwyerwHRGEN-em-abHHy-by-PFNeetsueh-sale miergreetim-writiwritinglySelershalrgpinealpiurliemsamiemsumhnaneer-te-be-keptin eod-standing-ant-fermasdiisiaas-eferfssre-adransFumdeEPMeFReRgaget)-amd-he mergage-moteamdsesuyagremeNEsNalbealhenwiseinmRaREceNeRremtregiredby-Seller: buEsehermeyonty-reeeausercisemarlyiboumeR-meRS#ekeEgeneles,amdseeurity grements-generaly-w#ze-y-mstllena-lenenders-R-commerela-ransaetienS-#-the-ceunty wheretmeReal-Prepenis-AEPersemalPepetyamdeusesbeingsonveyederasigned WAlpa-SeleFs-eptee-erof-sewriyy-sgremeEewteRreverded -The-Party-Fmaneing-Ths-Cemtretiscentingentupon-BuyerentamingsuHable-fmnaneing-with ate-and-terms-aeeprabie-e-Bwyeh,#-Bwyers-sers-sele-tisereten-Bwyet-shal-nave-te-rght-te emminae-his-COMERerehamdofaldepasitmonit-lygMimgselerwPiter-melice Femmnaien-eFHuresahansisNecing-ihn, dayseftne-bieetiye-Date-Upon eFRiRateR-PHESHaR-P-s-prewision-the-patier-shall-be-released-t Initials blgatiems-hereunder-ma-pessy-survive-tne-en CORFReE-BwyersFaHarele-tmelygivemelieeetieftemmimationshalrcemstweawaveroftherght e-Mengage-ASSERPHOR-TAS-CORaeHIS-eentingen-upepen-Bwyerbeigbie-0-a5SHme-the-existing mortgage AHRPcHERgeRN-ers-antEcemdRiens-e atan-imterestraterate-mette-exeed: %; Buyer-Buyer-shal Withil day-oFte-Efetive--sur-mtme-ai-Reesay PPhsatienr-imeludingthe-peymemtofal-rep-re-ppistepaRdSrssuRPion-es,e-the lender-tBwyerismoraprovedby-lender-within DAYS-OFTHE-Efeetive-Date,Orifthe equrements-ettneFeassumptenareeta-aecerdancewHelemsoPNSCORtRaet,eriflender hargesinexeessefinesgeedameut-lhenbayermeyeastieteminateltscHbygiing WFe-sotieele-selewihnsaid-imelerapppa-améreevesreimdoefany-depesitspaid. wnkes-Seleragres-in-writing-will busimess-days-aerreseptefbwyers-motieelepey-te erueinimeetieasdge-yhrmyheemstiseofleminien  ys  tnaneingstatements.  urts  eleminatehereunder:  and-tetar-mertgagee-charges-met-te-exeeeds  Vhiche hargehAepat Sellerer  Aalrcenstutea-wayereFtmergAHC-ermRae-hereunder:  5. TITLE. INSURANCE: Seller, at Seller's expense, shall deliver to Buyer or Buyer'sa attorney, or X Buyer, at Buyer's expense, shall obtain, within 30 days of the Effective Date, a title insurance commitment, with the premium for the owner' S policy tol be issued at closing to be paid by Seller K Buyer. The title insurance commitment shall bei issued by al Florida licensed title insurer agreeing toi issue to Buyer, upon recording of the deed to. Buyer, the owner's policy oftitle insuranceint thes amount oftlepur.hasepneinsumg Buyer'stitleto the Real Property, subject only tol liens, encumbrances, exceptions or qualifications set forthi in this Contract, and those which shall bedischarged by Seleratorbeforeclosing. Sellershall convey marketabletitesubject onlytol liens, encumbrances, exceptions or qualifications specified in the Contract. Marketable title shall be determined according to applicable Title standards adopted by authority oft the Florida Bar and in    accordance with law. Buyer shall have 7 days from date of receiving the title commitment to examinei it. Iftitleisi found unmarketable ori notin compliance with this Contract, Buyer shallwithin said 7 days, notify Seller in writing specifying defect(s). Ifthe defect(s) render title unmarketable, Seller will have 60 days from receipt ofr notice within which to remove the defect(s), failing which Buyer shall have the option of either accepting the title as it then is, or demanding a refund of deposit(s) paid which shall immediately be returned to Buyer, and this Contract, andtherightsand obligations of the parties hereunder, shall terminate, except those which expressly survive the termination ofthis Contract. Sellers shall,iftitlei is found unmarketable, use diligent effort to correct defect(s) in the title within the time provided therefrom, but not including the institution of any 6.3 SURVEY: Seller, at Seller'se expense, or Buyer, at Buyer's expense, within time allowed to deliver evidence oft title and to examine same, shall or Kmay have Real Property surveyed and certified by a registered Florida surveyor. If survey shows encroachment on Real Property, or that improvements located on Real Property encroach on setback lines, easements, lands of others or violateanyrestrictions, Contract covenants or applicable governmental regulation, the: same shall 7. CLOSING: This transaction shall be closed, the deed, other closing papers and possession delivered, and thel balance ofthe purchase price paidonorbefore the earlier of10 days from receipt offunding for the Hometown Revitalization Grant previouslya awarded tot the Buyeror60days: after thel EffectiveDate, unless extended by other provisions ofthis Contract. Closing shalll bel heldint the county in which the Real Propertyis isl located att the officeofana attorney ortitleagency designated by Seller. Unless otherwise agreed, closing shall take place between the hours of 8:00 a.m. and 6:00 8. CONVEYANCE; TITLE, RESTRICTIONS AND USE: Seller shall convey the Real Property by SPECIAL WARRANTY DEED, unless otherwise provided, subjectto:(Ozoning. restrictions, prohibitions and other limitations imposed by governmental authority; (ii)restrictions and matters appearing on the plat or common to the subdivision; (iii) public utility easements of record; provided the same are located contiguous tot thel Real Property lines, not more than 101 feet in width stotherearorfrontines and' 7.5 feet in width as to the side lines, unless otherwise provided herein; (iv) taxes for the year of closing and subsequent years; (v) any purchase money mortgage or mortgage(s) to be assumed; and (vi) such other matters as are approved by Buyer or set forth in a Permitted Exceptions Addendum, if attached hereto, provided none ofthe foregoing shall prevent the use of the Real Property for commercial purposes. Personal Property shalll be conveyed by ana absolute Bill lofSale, freeand clearofalll liens, unless otherwise provided herein.  suit or proceeding.  constitute at title defect.  p.m., and not on a Saturday, Sunday, or national holiday.  Initials  9. CONDITION AND SUITABILITY OF PROPERTY:  As Is  (a) DJ As Is: The property is being sold "AS IS." Buyer shall have a30 calendar day period ("Inspection Period") from the Effective Date, in which the Buyer, or his designated Agent(s) will be allowed to enter onto the Property, at reasonable times and with prior notice to Seller, to perform inspections sandtestsa as ysdmcuyltmint inl Buyer'ssolediseretion, that the Property is suitable forl Buyer'sintendedi use, including but not limited to, surveys, soil borings, environmental audits, termite and wood destroying organisms, HVAC, mechanical, plumbing, electrical, roofand structural. Such inspections or tests shall be made at Buyer's sole expense. Buyer shall be responsible for any damages sdyahisetimpstios ands shallindemnify andholdSelerhammles: fromanydamageorinjuy top peonefpopstymnomeston withanysuch inspection or test. Should Buyer notify Seller or Seller's agent in writing prior to the expiration of    the Inspection Period that the Property is not suitable, in Buyer's sole discretion, all deposits shall ber refunded tol Buyer, and this Contract, and therights and obligations oft the parties shall terminate, except as to matters which expressly survive the termination of the Contract. Buyer's failure to timely give notice oft termination shall constitute a waiver oft the right to terminate hereunder. Geed-Werking-Ohie-Saler-wamaN-hwre-seilig-waffimawing-the-faseia-and sefAestererandmtimeorwals-denehveanyvisibecvdenseoflas-waterdamage-on SEructaral-damage-andal-meehania-kems-heating-celng-eietmea-amdplumbing-systems né-machmeyandaleplancesareingpdweningende-aswaranyshal-motsurvivethe esimgeFrcemEet-Bwpershalhave ealendarday-pericePimspetiei-Pen-Peried"-from-the EetivePate-inwhehh-BbayererayefsdeigalaisemmiflonaaComineier,emgineerer rehtet,Wilbealowweie-merometelhePepy-drsemaetimesaRéwethpriermeticete Selerepeéasehipsaaisir-Syerwedsmnethsraet the-warranted-items-are-n-geod-werking-cendition-er-fiee-fomr-dees-8-warranted-Sueh aspections-ertestsshAe-maeabye-sele-epse-byershiereperespensibe-terany damages-eaised-bysuhisisetimpsiiasamishlimsendmayamdhalselerhammiess-em ny-damegeerinjusy-epemoorpeperyinsmnesiomwilwihnysehimpestiemeriest-Buyer: ha-moty-seHer-wEtingbeteretheewpationefthe-inspeetem-Periedetany-deleets-Hitems warated-fFreplaeemieFPIERRereiehmSelershaleusethe-saeebe-madete EP--NegeawewRs stmaebyelicesedRceHERdeRkegnserereReis: Ifthe-cests Fsehrreplaemenbrerrepeirs-eneesedamcemtk-aeneeherselererbwwyer-mey-pey-te esame.Rgtedesepyyi"ing-riteisete he-ether-UponRAOR-pHESHARtOthSprevisIen,a'depesis-SAAand the Paries-shal-be-eiestfom-flutherishtaméobigatioms-herunde,eNexeeptas-te-matters whieh-express-swvivethereFPHRAtOR-OES-CORtFaet-Bwyers-aHUe-e-egve-nelee-et defet:shal-censtiuieRAsePaRseefihecemitiemefaheFl-RmtPmpeyamda-waiveref-the e-Mantenamee-Bewee-etHetive-Dateanehedateerelesing-eeepterrepais-requred pursuant te paragraph-96b) Saler-shal-masaa-Pe-i.ig-heurnstimiste-ree eehanealsystes-eambngsysems-aAReHVACSP.tems-thelawrend sarbbery-i-the-sen-semdition-aseNseMising-w-he-FResive-Dw-eninary-wear-and-tear O-PERMEFTING: Bwyershal-nave-s: irdyristewww Eestive-Datete-detedsteminesemplansewilgevemmeiairegalatioms-erBwyers-intendeduse Fthe-sabyestprepertyaméeahadlm-eaneameNabuldimgelsr plerreuiredgevemmeer-appreval-erlhedewelepmeEoe-Prepery-cCiy-Ceunty-and State-etFlerida-erdimanees-am-reguatioms-are-cestanty-bengrevised-as-e-and-use,zemng: permitting amd-vesiel-igls-Phe-Bayeradawiage-w-eselerami-Biekert)-make-se epresemiationastewheherihesayasPePepeyssuaelerbyesimemaause-Bwyerhasthe bilityderingthe-PermtingPenadiedereminecomplancewthreguatonsterstorBwyersimended se-efthe-Prepery-amé-wihale-Sekeramt-Basker-hamses-fem-any-demage-caset-by BayesimbiliyeisekePwpyiilanivelieshaing-fin Bayers-sele-diseretien, the-required gevermentar approvals-cammet-be-ehein-wihn-e reasenable-time-trmeorexpenseBwyersha-meHy-SeHererSeHelersagemtWRRS-PReFte he-expiration-eFte-Pemmiting-Perind-emi-al-depasis-sis-hal-he-reamaal-te-Bwyer-Upon misiw-pusate-Neteawe-amthrt-an4 ebligatiens-hereundereNep-a-te-mse-whid-epresyswvive-the-temminatien-eF-his  gh-te-terminate-hereunder:  exeepted.    Centraet, BuyersaluneieimelyeaefimaianuiwshawmsiNeewaiveroftherish  e-ermmatehereunder:  Initials  #WOODDESTROVNCONCAMNSN-RatPwvith puremseu erNe Bayer-at-Bwyes-ewpe-wihaNe-laspectea-Periad e-alimpasgphSmeyha-aiPewpilyefiaaCeiiaPws:Camei Opersteriedetemmineiflhereisanyvisibleseiveiemmieintsaion-onddesireyingerganisms orvisibedemagetetheielheimpowemeseomMtesmme-Feeererhothareiaume,buyershalthave -daystrom-date-osaidrepertwthnwhehie-avealdamges-wwhethervis-bleermot-inspeeted ndesimsetbyalieehisemalhulerergenkewmiewr-Selershalpyvalteestseftreaiment rew Sheule-sueh-eests-exeed-thatameunt-and-sel"releets-met e-pay-te-same,the-te-Buyershalr-hevetheepHeneleanetng-COnretwAhRs-deys-after-receipt ofcentraetersrepairesimsebygHimgAe-eliselesesele,e-lyermeyelete-preed withthe-rensaetien-irwhdheven-wyershalrseivesersralarclsingefanefamameumtegahe 12. HAZARDOUS SUBSTANCE: Seller represents that Seller has no knowledge of any toxic, petroleum, asbestos orhazardous substances beingstored, used or otherwise released on thes subject Property. Buyer acknowledges that Buyer has the ability to audit the subject Property during the herein described Inspection Period and to terminate this Contract and receive a refund of all deposits in the event any are found and Seller is not willing to pay the costs of removal or remediation. BuyermayterminatetheContract tbygiving "ewEre tothe expiration ofthel Inspection Period. Buyer'ss soleremedy for such contaminates found on site shall be the termination of the Contract and return of any deposits, unless Seller has herein 13. RADON GAS: Radon is a naturally occurring radioactive gas that, when it has accumulated in a building insufficient quantities, may present health risks toj persons who are exposedtoitovertime. Levels ofradon that exceed federal and state guidelines have been found in buildings in Florida. Additional information regarding radon and radon testing may be obtained from your county public 14. BUILDING-ENENERGYEPHICIENCK-PursuaRHe-Sevtion-ss3.996,Flerida-Staues,Buyermay-have-the e-#my-eFRe-aNEresNsA-GAERN Buyer-aekmewledges-recept-efthe 15.AMERICANS-WIH-PISABILEIES-ACT-A-D.A-D-A-Pe-A-DA-makes-taawalte-diseriminale ganspepie-wirdisaayafikv-alimpovst. prepertics-reguiring-eqpwa-aceess-and serise-e-dsabd-indds-Pe-bwyr-sageeF-BreeF-make-ey PresemaseR-Se-whPePepeyasbmee,ADA-e4 Sellerami-Bekerhammi-iaheeweppeydNssEReADA-samiani-Thi-previsionshal 16. LEASES: Sellerwarrant'st thattherea arei nol leases in effect fortheproperty except as disclosed in 17. EXCHANGE: Buyer and Seller agree to cooperate with each other in completing a 1031 Taxl Free Exchange under the Internal Revenue Code by arranging closing to qualify for such exchange and by completing such additional documentation as may be reasonably necessary. to accomplish the same; provided, however, the partner desiring the exchange shalll be obligated to assume all liability or cost associated withs such  hecesterthetreatment-antrepatrestmate-me-mOH-eNeess-eESetsad-amout:  misrepresented Seller's knowledge of thesame.  health unit.  Forida-Bulding-Eneg-BHieene-RalaingSysiem-afaemsermatienBroehure.  Survive-the-elesing  theLease Addendum attached to this Contract.    exchange. The party not desiring the exchange shall not be required to purchase an exchange parcel, nor shall thet terms ofthis Contract, including the date ofclosing, ber modified as a result of compliance with the terms of 18. INGRESSANDEGRESS: Sellerwarrants: andi represents thatthereisl legal ingress ande egresstothe 19.LIENS: Seller shall furnish to Buyer, at time of closing, an affidavit attesting to the absence, unless otherwise provided for herein, of any financing statements, claims of lien or potential lienors known to Seller and further attesting that there have been no improvements or repairs to the Property for 90 days immediately preceding date ofclosing. IfProperty has been improved or repaired within that time, Seller shall deliver releases or waivers ofmechanics' liens executed by all general contractors, subcontractors, suppliers and materialmen in addition to Seller's lien affidavit setting forth the names of all such general contractors, subcontractors, suppliers and materialmen and further affirming that all charges for improvements or repairs which could serve as al basis for ai mechanic's lien or a claim for damages have been paid or will be paid at closing of  this provision.  Real Property, title to which is in accordance with paragraph 5 ofthis Contract.  this Contract.  Initials    20. TIME: Time periods herein of less than 3 days shall in the computation exclude Saturdays, Sundays and state or national legal holidays, and any time period provided for herein which shall end on Saturday, Sunday oral legal holiday shall extend to 5:00 p.m. ofthe next business day. 21. DOCUMENTS FOR CLOSING: Seller shall furnish the deed, bill of sale, mechanic's lien affidavit, assignment ofleases, tenant and mortgagee estoppel letter, corrective instruments, and 22. EXPENSES: Seller acknowledges and agrees that the Buyer is exempt from payment of documentary stamps on the deed and as such, Seller shall pay all documentary stamps and thecosts ofrecording ofany corrective instruments. Recording fees to record the deed, any purchase money 23. PRORATIONS, CREDITS: Taxes, assessments, rent, interest, insurance and other expenses and revenue oft the Real Property shall be prorated through day before closing. Cash at closing shall be increased or decreased as may be required by prorations. Prorations will be made through the day prior to closing, unless otherwise provided herein or agreed in writing. Advance rent and security deposits will be credited to Buyer, and escrow deposits held by the mortgagee of a mortgage to be assumed will be credited to Seller. Taxes shall be prorated based on the current year's tax with due allowance made for maximum allowable discount, and other exemptions. Ifclosing occurs at a date when the current year's millage is not fixed and current year's assessment is available, taxes will be prorated based upon such assessment and the prior year's millage. Ifcurrent year's assessment is not available, then taxes will bej prorated on the prior year'stax. ftherearecompleted improvements on the Real Property by January 1st of the year of closing, which improvements were not in existence on January 1st of the prior year, then taxes shall be prorated based upon the prior year's millage and at an equitable assessment to be agreed upon between the parties, failing which, request will be made to the County Property Appraiser for an informal assessment, taking into consideration available exemptions. Any tax proration based on an estimate shall, at request of either Buyer or Seller, be subsequently readjusted upon receipt of tax bill on condition that a 24. SPECIALASSESSMENTLIENS: Certified, confirmed: landratified special assessment liens as of dateofclosing (not as of Effective Date) are to bej paid by Seller. Pending liens as ofd date ofclosing shall be assumedbyBuyer.Itheimprovement haubhmahumialympledaofEiaeiheDas. suchpending lien shall be considered certified, confirmed or ratified and Seller shall, at closing, be charged an amount equal tot the last estimate ofassessment fortheimprovement byt thepublicb body. 25. RISK OF LOSS: Ifthe Property is damaged by fire or other casually before closing, and the cost of restoration does not exceed 3% ofthe assessed valuation of the Property SO damaged, cost of restoration shalll beand obligation ofthe Sellerand closing shall proceed in accordance withi theterms ofContract with restoration costs escrowed at closing. Ifthe cost ofrestoration exceeds 3% ofthe assessed valuation oft the improvements SO damaged, Buyer shall have the option ofeither taking Property asi is, together with either the 3% or anyi insurance proceeds payable by virtue ofsuch loss 26. ESCROW: Any escrow agent ("Agent"): receiving funds or equivalent is authorized and agrees by acceptance of them to deposit them promptly, hold same in escrow, and, subject to clearance, disbursethem in accordance with terms and conditions of Contract. Failure of clearance of funds, shall not excuse Buyer's performance. Ifin doubt as to Agent's duties or liabilities under the provisions ofContract, Agent may, at Agent's option, continue to hold the subject matter ofthe  closingstatement. Buyer shall furnish all third party loan documents.  mortgage and any financing statements shall be paid by Buyer.  statement to that effect is in the closing statement.  orc damage, orofcanceling this Contract and receiving return of deposit(s).    escrow until the parties mutually agree to its disbursement or until a judgment of a court of competent jurisdiction shall determine the rights of the parties or Agent may deposit same with the clerk ofthe circuit court havingj jurisdiction ofthe dispute. Upon notifying all parties concerned of such action, all liability on the part of Agent shall fully terminate, except to the extent of accounting for any items previously delivered out ofescrow. Ifal licensed real estate broker, Agent will comply with provisions ofChapter 475, Florida Statutes, as amended. Any suit between Buyer and Seller wherein Agent is made a party because of acting as Agent hereunder, or in any suit wherein Agent interpleads the subject matter of the escrow, Agent shall, unless found to have defaulted under Agatisespwandersaoy, dimis.moverasomaheatomey'sfesandesis incurred with the fees and costs to be paid from and out of the escrowed funds or equivalent, or reduced to. judgment ifsaid escrow funds are not available or are insufficient to pay the award. Parties agree that Agent shall not be liable to any party or person formisdelivery tol Buyer or Seller ofitems subject to this escrow, unless such misdelivery is due to willful breach ofthis Contract or  gross negligence of Agent.  Initials  27. ATTORNEY'S FEES, COSTS: In connection with any litigation arising out of or instituted for the purpose of enforcing this Contract, the prevailing party in such litigation shall be entitled to recover reasonable attorney's fees and costs. For the purposes of this General Provision, Seller, Buyer, listing broker, selling broker, buyer's broker, and anys subagents ofthesames shallb be eligible 28. FAILURE OF PERFORMANCE: Iffor any reason other than a failure oftitle or breach of any covenant to be performed or met by Seller, Buyer fails to close, the Seller's sole remedy shall be tot terminate this contract. Ini the event ofac default be Seller, Buyer shall havethe option ofany and all remedies afforded under the laws oft the State of Florida, at law ori in equity, including thei right 29. CONDEMNATION: If, prior to the closing hereof, all or any portion oft the Real Property is taken by eminent domain or is the subject of a pending taking which has not been consummated (hereinafter collectively referred to as a"Taking"), Seller shall give Buyer written notice ofsuch, and Buyer shall have the option to either (i) terminate this agreement, or (ii) proceed with the closing in accordance with the terms of this Contract. Buyer's written election shall be delivered to Seller not later than 15 days after receipt of written notice from Seller, but in any event priort to closing. Ifthis agreement is terminated as aforesaid, neither party shall have any further rights or obligations tot the other hereunder, except fora any matters whichs specifically survivet termination of this agreement. IfBuyer does not elect to terminate this agreement as aforesaid, Seller agrees to assign to Buyer, at closing, all sums which aret tol be awarded for the Taking and give credit forany deposits or payments already received by Seller, Buyer shall thereafter be entitled to receive and 30. CONTRACT NOT RECORDABLE, PERSONS BOUND, NOTICE: Neither this Contract, nor any notice ofit, shall bei recorded ina any publicn records. This Contract shall bind and inuretothe benefit oft the parties and their successors ini interest. Whenever the context permits, singular shall includeplural andone gender shall include all. Noticegiven byortotheattorney for any party shall 31. OTHER, AGREEMENTS: Nopriororpresent. agreements or yprsetatoshalle.hinain: upon Buyer or Seller unless included in this Contract. No modification or change in this Contract shall be valid or binding upon the parties unless in writing and executed by the party or parties intended  parties.  tospecific performance.  keep any award for such Taking by eminent domain.  bea as effectiveasi ifgivent by or to that party.    tob bel bound byi it.  32. BROKERS: Buyer and Seller represent to each other that neither have dealt with an undisclosed Broker in connection with this transaction, and that no commission is due from Seller or Buyer to any person except as agreed in writing by the party sought to be charged with such commission, except as  follows: (a) Broker: Isa an agent of (specify): (b) Broker: Isan agent of (specify):  N/A  who  SELLER, or BUYER, or is a Transactional Broker, and who will be  compensated by SELLER, or BUYER, or  both parties pursuant to a listing agreement or other  N/A  who  SELLER, or - BUYER, or is a - Transactional Broker, and who will be  compensated by 7 SELLER, or J BUYER, or  both parties pursuant to a listing agreement or other  (c) Indemnification of Broker: In connection with any act relating to the property, including, but not limited to, inquiries, introductions, consultations and negotiations resulting in this transaction, Seller and Buyer agree toi indemnify and hold harmless any Broker identified herein from and against losses, damages, costs and expenses, including reasonable attorney's fees, and from liability to any person arising from (i) compensation claimed which is inconsistent with the representation in this Paragraph, (ii) any duty accepted by broker at the request of Seller or Buyer, which duty is beyond the scope of services regulated by Chapter 475, Florida Statutes, as amended from time to time, or (ii) the recommendation. ofor services provided and expenses incurred by any third party whom broker refers, (d) Attorney's Fees: In connection with any proceeding between any broker identified ini this contract and Seller or Buyer to collect a brokerage fee pursuant to this Contract, the prevailing party shall be e-DepasitFBwyeraetmNyeceeimgtae-Bekers ee-as-previded-abeve-sh-be-paid-te-Brekeras-fl-cempensatien-ter-Breokers-serviees-imelading-eesis pemdalbyBke-mepaw-hatasalataisehsususesfile relisa-erfaHureetSelerieperiomsSelershapey-ie-leie-Biokeron-Demand: (f) Indemnification of Buyer: Seller agrees toi indemnify and hold Buyer har Initials losses, damages, claims, costs and expenses, including reasonable attorney's rees, and trom l1aDility toany person arising from compensation claimed which is inconsistent with the representations in this  recommends or retains for or on behalfofE Buyer or Seller.  entitled to recover the costs thereof, including reasonable attorney's fees.  Contract.  33. TIME OF ESSENCE: TIME IS OF THE ESSENCE IN THIS AGREEMENT. and shall not be construed to alter or amend any provision ofthis agreement.  34. HEADINGS: Thel headings on each paragraph and subparagraph are: for the convenience ofthe parties 35. NOTICE AND ADDRESSES: Any notice required or provided for under this agreement shall be effective upon receipt by the addressee, upon hand delivery during regular business hours or mailed by certified mail, return receipt requested, express or similar receipted delivery, or confirmed 36. GOVERNING LAW AND VENUE: This agreement shall be construed in accordance with the laws of the State of Florida. The venue of any litigation arising out of or instituted for the purpose of  facsimile.    enforcing this Contract shall be in the county in which the Real Property is located. 37. ASSIGNABILITY: Buyer - may assign or may not assign this Contract or any rights 38. ADDENDUM: There is or is not an Addendum attached to this Contract. 39. LICENSE DISCLOSURE: 7 Seller Buyer discloses that said party is a licensed real estate ACENCEAAGEADNUSTNENP-hewa himiSaneywe-epwPisergsraaw aeres,then-in-that 41. OTHER PROVISIONS: The closing of this Contract is contingent upon funding for the CDBG-  hereunder to an affiliated entity.  broker.  eventthepurehase. Pseshalbendsiediesedtereletepriseefs Hometown Revitalization Grant that Buyer has previously been approved for.  THIS IS INTENDED TO BE. A LEGALLY BINDING CONTRACT. IF NOT FULLY UNDERSTOOD, SEEK' THE  ADVICE OF AN. ATTORNEY PRIOR' TO SIGNING.  (BUYER) Date  (SELLER) Date  Social Security or Tax ID#  Social Security or Tax ID#    SECTION 00010 ADVERTISEMENT FOR BIDS  PROJECT NAME: Town of Sneads Sewer Lift Station #4 Rehabilitation 2023 Sealed bids, submitted in triplicate, will be received by the Town of Sneads, Florida, (Owner),  until2:00p.m., local time (CT), Tuesday.July1 18,2023 at the office of:  Lee Garner, City Manager Sneads Town Hall 2028 Third Avenue Sneads, Florida, 32460  for the construction of the following described Project:  Sewer Lift Station #4 Rehabilitation, including new wetwell, duplex submersible pumps, valve box, piping and valves, emergency generator, electrical & controls, site grading, fencing, & Bids will be opened and read aloud at Sneads Town Hall at 2:00 p.m., July 18, 2023. Plans, specifications, and contract documents will be open to public inspection at the office  demolition of existing facilities.  listed above or may be obtained from:  David H. Melvin Consulting Engineers Attn: William C. Nobles, P.E. 4428 Lafayette Street, P.O. Box 840 Marianna, Florida 32447 (850)482-3045  upon payment of $150.00 per set which amount constitutes the cost of reproduction and handling.  This payment will not be refunded. Electronic copies will be provided at no cost. Avenue, Sneads, Florida, 32460, ats 9:00a.m.CT.ThursdayJune 29,2023.  A non-mandatory pre-bid meeting shall be held at the Sneads Town Hall, 2028 Third The Owner reserves the right to waive any informalities or to reject any or all bids. Each Bidder must deposit with his/her bid, security in the amount, form and subject to the conditions provided in the Information for Bidders. Sureties used for obtaining bonds must appear as  acceptable according to the Department of Treasury Circular 570.  No bid may be withdrawn for a period of sixty days after the scheduled closing time for Attention of Bidders is particularly called to the requirements as to all applicable laws and regulations of the Federal government and State of Florida, and bonding and insurance IN PARTICULAR, BIDDERS SHOULD NOTE THE REQUIRED ATTACHMENTS AND CERTIFICATIONSTO BE EXECUTED. AND SUBMITTED WITH THE FORM OF BID PROPOSAL.  receipt of bids. requirements.  EQUAL OPPORTUNITY EMPLOYER HANDICAP ACCESSIBLE/FAIR HOUSING JURISDICTION  00010-1 Adverticemant for Ride    Request for Waiver of the Town of Sneads Manufactured, Mobile, or Modular Home Ordinance  Tammy D Jackson 2046 Lou Ave Sneads, FL 32460 May 1, 2023 Sneads City Council Council Members,  Hi, my name is Tammy Jackson, owner of a property located at 2046 Lou Ave., at the corner of Lou and Foreman. I have spoken to the Jackson County Property Appraiser's office and confirmed that the measurements of the property at the aforementioned address are 210' X 100', 21,000 square feet. I currently have a double wide mobile home on the north side of the property with the remainder being vacant land. I understand the Mobile Home Ordinance currently in place specifies that "the property size must be a minimum of % acre, which is 10,890 square feet", and that "the number of manufactured, mobile, or modular homes permitted on each property shall not exceed two (2) homes per acre". Ip perceive this to mean that at least % of an acre, or 21,780 square feet, would be the minimum requirement for placing two mobile homes, My property is 780 square feet shy of being the full % acre. lam wanting to allow my daughter and granddaugnter to place one mobile home in the south east area of the currently have cut and stacked downed pines, residual from Hurricane Michael, as well as a stack of concrete culverts, property was purchased with them present, in the south east area of the property. Please be assured that if the waiver should be granted, these things would be cleared from the property before any other work begins. Ihave spoken to Mickey Perkins already about removing the culverts and am now waiting for them to acknowledge, and am happily obliged, to follow all requirements of the ordinance if the waiver should be granted. If granted, the shopping process would be started SO that all inspections, submissions, approvals, reviews, and permitting set forth by the ordinance  which leads to my request for a waiver.  parcel.  be removed.  could take place. Best Regards,  Thank you for your consideration!  laya  Tammy Jackson (850)209-5691    qPublic.net Jackson County, FL  Overview  E  Lp  Legend Parcels Roads  HIIFEO 148ft Parcell ID Sec/Twp/Rng 28-4N-07 Property Address 2046LOUAVE District Brief7 Taxl Description Datecreated: 5/15/2023 Last Datau Uploaded: S/15/20235:09241AM Developedby 6 Schneider  84N0/0169.0000390 Sneads 12  Alternate ID 0742801690000330 Class MOBILEHOME Acreage n/a  Owner Address JACKSONT TAMMYD  2046LOUAVE SNEADS,FL32460  LOTS3GAMOUSUBDLORIO (Note: Not tob be used on! legalc documents)    810.0 AVE. 2/0.0 61  0.0  a/0.0  210.3  210.0 C 0  saleil 7 Bradyhtefel  G 00  5 2  G  s  5 -  PJ 210.0 2/0,0 R  2/0.0 210.0  JJ  54.4  210.0 AVE. 2/0.0 S  LOC  y N  &  0 90     0 e et    Town of Sneads PO Drawer 159 Sneads, Florida 32460  PH (850) 593-6636 Fax (850)593-5079 Email: Sneadsmgr@-neadil.com  June 9, 2023  MEMOTO: Council President and Council Members SUBJECT: Town Manager's Report to Council - June 2023  1.  Iwanted to inform you that I am making major operational changes to personnel at our WWTPto save money and provide ai more efficient operation. IH have terminated our consultant contract with Castleberry Environmental effective. July 1, 2023, and will be bringing on Dennis McDaniel and Blake Fitzsimmons, both certified water and wastewater operators. I have terminated Justin McKinnie as of. June 29, 2023, and we will transfer the part-time employee to the Maintenance Department. Our total salaries will increase al little, but we will more than off-set them with cost savings in utility, maintenance, chemical and sludge disposal expenses. Also, we will not be paying a contractor to come and do every  little mechanical repair, as this will be done mostly in house.  2. 3.  We will have agenda items to authorize the contract and sale of property located at 1989 and 1995 We will finally have information regarding going out for bids again on Lift Station No. 4 with pre- bid meeting at Town Hall on June 29, 2023, and bid opening on. July 18, 2023, at 2 PM. Sure hope the  Gloster Ave as part of our action items. Copies of paperwork are attached for your review.  bids come back close to our approved amount.  4.  Also, Ihave attached correspondence from Ms. Tammy Jackson, owner of property located at 2046 Lou Ave requesting a variance to locate a mobile home on her lot. Based on her request, I recommend we approve it as an administrative variance, unless you desire to go to a public hearing which  will take 60-90 days for the complete process to occur.  5.  Our mosquito fogging machine is on its last leg and very old. We asked for a quote on a new one that came back at $14,500 from our current supplier. After searching the internet, we found a new one that has a dented gas tank from CenTark Truck and Equipment Co. in Jacksonville, AR at a price of $6973.00 with all the new warranty. Due to this being an emergency purchase, I authorized it to be purchased and we will use ARPA funds to pay for it. Should arrive sometimes next week. If feel this saving of $7527 is fully. justified, as Icontinue to look at all our expenses with a view to getting the best price possible. Iwanted to let you know that Sherriff Edenfield has donated us a used Ford Explorer and we will be picking up two used Ford Crown Victoria'si from the Pat Thomas Academy next week. Hopefully this will allow us to go another year without the purchase of new police vehicles, although we are looking into a lease program for future police car purchases. Please thank the Sherriff when you see him again. 7. Iwill be on vacation next Thursday and Friday to attend the. American Legion. Annual Conference in Orlando and will be having my right knee replaced on June 26th. I hope to be out only a couple of days  6.  due to the surgery.    8.  It appears our grant authorization for expenditure of funds is beginning to move in FDEM and FEMA, as we are hopefully getting close tol having construction start soon on our projects. Ihave attached  some correspondence for your review and information.  9.  Iwant to thank Chief Weeks and his officers for taking part in community activities and hope they can continue to be seen doing things to let our citizens know they are being active and participating. Chief Weeks is visiting all the businesses in town to re-assure them things are being taken care ofa and his department is ready and willing to serve as needed. The Fire Department continues to respond to calls in an efficient and timely manner and it is very much appreciated. I am happy withl how all the departments are being ofs service to our citizens and with the changes being made in the WWTP we will see definite  improvements soon.  AAER  ELMONEEE GARNER, TOWN MANAGER CC: Town Clerk, Deputy Clerk, Town Attorney    CentArk Truck and Equipment Parts LLC 1028 Redmond Rd Jacksonville, AR 72076 (501)241-1804 ales@cenarpars.com www.centarxpars.com INVOICE BILL TO Danielle Guy Town of Sneads 2028 Third Ave Sneads, FL 32460 SHIP DATE 06/08/2023 ACTIVITY GUARDIAN95G4 Sprayer  CENARK TRUCK AND EQUIPMENT PARTS  SHIPTO Danielle Guy Town of Sneads 2028 Third Ave Sneads, FL 32460  INVOICE# 4808 DATE 06/07/2023 DUE DATE 06/07/2023 TERMS Due on receipt  SHIP VIA Estes Express  QTY 1  RATE 6,750.00  AMOUNT 6,750.00 6,750.00 0.00 223.00 6,973.00 $6,973.00  SUBTOTAL TAX SHIPPING TOTAL BALANCE DUE    00s 0e  Agricultural 8 Solutions  oazelis Environmental  Created Date Quotel Number 00019771 Expiration Date 10/27/2023  6/7/2023  ADAPCO, LLC d/bla Azelis Agricultural & Environmental Solutionsis pleased to provide the following quotation to:  Customer Product  TOWN OF SNEADS  Subtotal USD0.0000 USD 14,500.0000 USD 14,500.0000  GUAI EMERGENCY PENDANT G4  1,00  USDO.0r00 Fau USD 14,500.0000 Fac  GUA GUARDIAN 190G4' VARIABLE FLOW: SPRAYER 1:001EA  Total Amount  All prices quoted include freight tot thet final destination in the continenta 3 Tens Net 3G davs, fulTrms ane Dor dirons can be found on our website, mtbslazalsassuscomteemsanécundtions AN invoices hincnt $38 Environmeniz uBit Sun Shirge. Pieasef feel freet to Should you have any questions ori immediate needs, pleess coniaet 71 rbeinw. Wea aosse ir pssnityt to offer this quote  visit our website aty www.3 azelsaes-us.com toy view labels and product falien  and look forward tol hearing from you: soon.  Regards, Dan McCombie TSR Azelis A&ES Ganeimcombe@azaliscon (314)541-1972  T8003670659 ww.azelsaesus.com  Azelis Agricultural & Environmental Solutions  1324N. Hearne Ave., Ste "20. Shreveport. LA71107