SANJUAN COUNTY, COLORADO BOARD OF COMMISSIONERS TOWN OF SILVERTON BOARD OF TRUSTEES  MEETING AGENDA July 24, 2024  CALL TO ORDER: 6:00P.M. BOCC Meeting Minutes for. July 10, 2024 APPOINTMENTS  6:05 P.M. Petition for Abatement or Refund ofTaxes - Moorehead Property One 7:001 P.M. Resolution 2024-04 A Resolution Repealing The County Improvement And Development Impact Fee For Fire Protection, Rescue And Emergency Services 7:30 P.M. Resolution 2024-05 A Resolution Approving The Acceptance Of Donated Real Properties From Sunnyside Gold Corporation  LLC 50827 Highway 550 Durango, CO8 81301 6:30 P.M. Sheriff Bruce Conrad - CR2 As Enacted In Resolution Number 2022-11  CORRESPONDENCE: Sallie Barney NEW BUSINESS: Sunnyside Gold Land Transfer Sales Tax Update Public Comment Commissioner and Staff Reports  Joint Meeting with Town Board - September 5th 5:00 to 8:00 pm. Joint Meeting with CDOT Thursday, August 1st at 3pm  Possible executive session for the purposes of considering the possible acquisition of real property and possible formal action related thereto following executive session, consistent with CRS 24-6-402(4)(a): a and (e). A Possible executive session for the purpose ofdiscussing personnel matters, pursuant to CRS24-6-4024X000.  recording oft the executive session shall be kept for 90 days.  Ar recording shall be kept for 90 days.  Other Adjourn  Times listed above are approximate.  Discussion of an agenda item may occur before or after the assigned time.  Next Regular Meeting - August 14, 2024 8:30 A.M.  Join. Zoom Meeting pmu9IRTRON Meeting ID:92136473203  By Telephone: Dial 1 669-900-6833 and enter the Webinar ID 92136473203 when prompted. You Tube (live and recorded for later viewing, does not support public comment):  htps/ywyyoutuhe.com'gsmjunsumtycolonadostreams    SANJUAN COUNTY BOARD OF COMMISSIONERS REGULAR MEETING WEDNESDAYULY 10,2024  AT 8:30. A.M.  Call to Order: The meeting was called to order by Chairman Austin Lashley. Present were Commissioners Scott Fetchenhier and Pete Maisel, County Attorney Dennis Golbricht and Administrator William Tookey. Payment ofBills: Commissioner Fetchenhier moved to authorize payment of the warrants as presented. Commissioner Maisel seconded the motion. The motion passed unanimously. Minutes: Commissioner Maisel moved to approve the minutes of. June 26, 2024, as submitted. Commissioner Fetchenhier seconded the motion. The motion passed unanimous. County Assessor Kim Buck was present to provide the Commissioners to report the assessed value of Social Services Director Martha Johnson was present toj provide the Commissioners with an update. The Board of] Equalization Hearings were scheduled for. July 24, 2024 beginning at 5:00 pm. The Commissioners discussed the speeding and dust problems on CR2. Sheriff Bruce Conrad will be Aj public hearing was held for the Silver Cloud Lodge PUD Preliminary Application. Mr. Colby Barrett was present to answer any questions. Questions concerning the impact on wildlife and the financial feasibility ofthe project were raised by the public. Upon the completion of the public hearing the Commissioners had several questions for the applicant. The Commissioners discussed doing a site visit tol help determine the visual impact ofi improvements on the Bonanza Boy and the potential impact on wildlife and wetlands impact. They also requested that the applicant review reducing the parking on the Bonanza Boy. They also requested that the Avalanche Safey Plan be reviewed by an independent Avalanche Expert. Also requested was input from Colorado Parks and Wildlife. The applicant was asked if he would be willing to continue a decision on the Preliminary Application to a later date. The Commissioner Maisel moved to continue public hearing the Silver Cloud Lodge PUD Preliminary Application until a site visit and additional documentation to a later date. Commissioner Maisel The Treasurer's monthly report was presented to the Commissioners for their review.  San Juan County after completion of assessor protests.  invited to the next meeting.  applicant stated that he was in agreement with an extension.  seconded the motion. The motion passed unanimously.  Commissioner Fetchenhier moved to approve the Treasurer's Semi-Annual Report. Commissioner Administrator Tookey asked the Commissioners to consider cancelling the credit cards for former Deputy Clerk Linsley Sweet and former Road Supervisor Louis Girodo; to approve applications for current employees Rusty Melcher and Charles Alex Lanis with a $2500 credit limit; and to increase all  Maisel seconded the motion. The motion passed unanimously.    other county credit card to ai minimum of$2500. Commissioner Fetchenhier moved to approve the requests as presented. Commissioner Maisel seconded the motion. The motion passed unanimously. Commissioner Fetchenhier moved to go into Executive Session pursuant CRS Section 24-6-402(4)(b) for the purpose oft receiving legal advice from counsel. It was County Attorney Dennis Golbricht': S opinion that the matter constituted privileged communications and therefore no minutes or recording would bel kept. Commissioner Maisel seconded the motion. The motion passed unanimously  The Commissioner reconvened their meeting at1:52 P.M. Having no further business, the meeting was adjourned at 1:53 P.M.  Austin Lashley, Chairman  Ladonna L. Jaramillo, County Clerk    PETITION FOR ABATEMENT OR REFUND OF TAXES  County: San. Juan  Date Received July8, 2024 (Use Assessor's or Commissioners" Date Stamp)  Section!: Petitioner, please complete Sectionl only, Date: July 8, 2024 Month Day Year  Petitioner's Name: MOREHEAD PROPERTY ONE, LLC/ /MICHAEL J. MILLER, MANAGER Petitioner's Mailing Address: 1355 GREENWOOD CLIFFS, STE 150  CHARLOTTE Cilyo or Town R7101 50891320130019)  NC State  28204-2984 Zip Code  SCHEDULE ORF PARCEL NUMBER(S) PROPERTY, ADDRESS ORI LEGAL DESCRIPTION OFF PROPERTY  50827 HIGHWAY 550, DURANGO, CO8 81301-9602  Petitioner requests an abatement orr refund oft the appropriate taxes and states that the taxes assessed: againstt the thet taxes have been! levied erroneously ori illegally, whether duet to erroneous valuation, irregularity inl levying, Property was acquired for $1,500,000 (closing statement attached). 2024 value was reduced to  abovep propertyf fort thep property tax year 2023  are incorrect for thet following reasons: (Briefly describe why  clerical error, or overvaluation. Attach additional sheets if necessary.)  $1,500,000. Petitioner's estimate of value: true, correct, and complete. Please see attached Petitioner's Signature AgenfsSignature/ CA5Re Printed Name: Alexander Powell 'Lettero of agency musth be attached whenp petition iss  1,500,000 Value  2023 Year  declare, under penalty ofp perjury int thes second degree, that this petition, together with any accompanying exhibits ors statements, has been prepared ore examined by me, and tot the best ofr my knowledge, information, and belief,is  Daytime Phone Number 704,533-0036 Email mmiler@elis.ulpt.com Daytime Phone Number 817,264-9230 Email alxpowalgaltusyoupcom  3y  bya ana agent.  Thea aclual valuei int the Assessor's Recommendaltion: seclion does notir include 2023v value adjustments forr residential and commercial properties. Thea assessedy value andr resulling taxa amounts are calculaled fromt thea adjusled actual value. IftheE Board of County Commissioners. pursuantt tos3 39-1 10-114(1). C.R.S. or the Property Tax Administrator, pursuantt tos3 39-2-116, C.R.S., denies thep petitionf for refundo ora abatement oft taxesi inv whole ori inp part, the Petitioner maya appeal to theE BoardofA Assessment Appeals pursuant to thep provisions of $39-2-125, C.R.S. withint thirty days oft the enlry of anys sucho decision, 539-10-114.5(1). C.R.S.  Section!!:  Assessor's Recommendation (For Assessor's Use Only) Tax) Year 2023 Assessed Tax  Actual  Original 4,242,270 1,183,593 51,689.88 1,500,000 418,500 18,276.73 Abate/Refund 2,742,270 765,093 33,413.15 XA Assessor recommends approval as outlined above.  Corrected  Ifther request for abatementi is based upont the grounds of overvaluation, no abatement or refund oft taxes shall ber madei ifand objectiono orp protesl tos suchy valuation! hast beenf fileda anda al Notice of Delermination! hast beenr mailedt tol lhet taxpayer, 93 39-10-1140Xa)0XD). C.R.S. Tax) year: 2023 Protest? No Yes (Ifa protesty was filed, please attacha a copy oft the NOD.) Assessor recommends denial for the following reason(s): Purgatory Ski Area, which averaged around $41,000/acre.  The original 2023 value as calculated at $41,000/acre, based on! land sales int the Hwy 550corridor near  Imint Assessor'so or Deputy Assessor's Signature.  15-DPT-AR No 920-66/17    FOR ASSESSORS AND COUNTY COMMISSIONERS USE ONLY (Sectionl IlI ors Section IVr must be completed) Written Mutual Agreement of Assessor and Petitioner (Onlyf for abatements upt to $10,000)  Every petition fora abatemento orr refund fledp pursuantt tos $39-10-114, C.R.S. shall bea acted upon pursuant tothep provisions oft thiss sectionbyt the Board of County Commissioners ort theA Assessor, as appropriate, within sixr months ofthe date off filing suchp petition, S: 39-1-113(1.7). CR.S, tor review petitions for abatement or refund and tos settle byv written mutual agreement any such petition for abatement or refund in ana amount of $10,000 orl less per tract, parcel, orl loto ofl land or pers schedule ofp personal The Assessor: and Petitioner mutually agree to the values and taxa abatementrefund of:  Section : The Commissioners of  County authorize the Assessor by Resolution No,  property, in accordance with S 39-1-113(1.5), C.R.S.  Tax) Year Actual Assessed  Tax  Original Corrected Abate/Refund  Note: Thet total taxa amount does noti include accruedi interest, penalties. and fees associated withl late and/or delinquent taxp payments, if  applicable. Please contact Ihe County Treasurer forf fullp payment information,  July 8, 2024 Date July 8, 2024 Date  Petitioner's Signature Assessor's or Deputy Assessor's Signature (Must bec completed ifs Sectionl Illo does nota apply) WHEREAS, the County Commissioners of San Juan called regular meeting held on ofs said County and Assessor Petitioner 2023  Section IV:  Decision of the County Commissioners  County, State of Colorado, ata duly andl lawfully  /2023 atv which meeting there were present thef following members:  Month Day Year  with notice ofs such meeting and and opportunity tot bep present having been given tot the Petitioner and the Assessor County Commissioners have carefully considered the within petition, and are fully advised inr relation thereto, NOW BE IT RESOLVED that the Board (agrees--does not agree) with the recommendation: oft the Assessor, and that the petition be approved-approved. in part--denied) with an abatementrefund asf follows:  (being present--not, present) and  Name  (being, present--not, present), and WHEREAS, the said  Name  Year Assessedy Value Taxes Abate/Refund  Chairperson oft the Board of County Commissioners" Signature  County Clerk and Ex-Officio Clerk oft the Board of County Commissioners  ina and for the aforementioned county, do hereby certifyt that the above and foregoing orderi is truly copied from the IN WITNESS WHEREOF, haveh hereunto set my hand and affixed thes seal ofs said County  record oft thep proceedings oft the Board of County Commissioners.  this  day of_  2023 Year  Month  County Clerk's or Deputy County Clerk's Signature  Note: Abatements greatert thans $10,000p pers schedule. pery year. must bes submitted in duplicate to the Properly TaxA Administrator forr review:  Section V:  Action of the Property Tax Administrator (For alla abatements greater than$ $10,000)  The action oft the Board of County Commissioners, relative tot this petition, is hereby  DA Approved D Approvedi inp parts $  D Denied for thef following reason(s):  Jy 23 Date  Secretary's Signalure 15-DPT-ARI No: 920-56/17  Property Tax Adminisirators Signature    AGENT AUTHORIZATION MOREHEAD PROPERTY ONE, LLC  TO ALL STATE, COUNTY, CITY & OTHER PROPERTY TAXING  ADMINISTRATIVE REVIEW BOARDS, TAX COMMISSIONS AND/OR JURISDICTIONS, COLLECTION Altus Group US, Inc, P.O. Box 92129, Southlake, Texas, 76092, (817) 251-6666, agents and employees are hereby appointed as our agents to prepare and file real its property and business personal property returns, receive and respond to all compliance filing correspondence, file protests, receive and respond to all appeal and meet with appropriate officials and other personnel of the taxing, jurisdictions correspondence, for the purpose of negotiating settlements of property tax valuations and of each state in the matter of property taxation of real and business complying with the laws owned by the undersigned taxpayer or in which the undersigned personal taxpayer property has an ownershipi interest. This authorization shall remain! in force and effect for the 20231 tax year and abatement petition for the same 2023 tax year.  ENTITIES.  Signed the  84h  day of  July  2024. Agent Information Altus Group, US Inc. Alex Powell P.O. Box 92129 Southlake, TX76052 817-264-9230 Am:Pomaegaltungroupcon  MOREHEAD PROPERTY ONE, LLC 50827 HIGHWAY 550 DURANGO, CO 81301-9602 SAN. JUAN COUNTY ACCOUNT: #R7101 50891320130019)  MICHAEL. J. MIL(ER, MANAGER MOREHEAD PROPERTY ONE, LLC, ANORTH CAROLINA LIMITED LIABILITY COMPANY 1355 GREENWOOD CLIFFS, STE 150 CHARLOTTE, NC 28204-2984  dM  Before me, a duly commissioned Notary Public within and for the State and County aforesaid, personally appeared Micheal J. Miller, known to me to bet the person who signed thei foregoing instrument and acknowledged to me that (s)he the purposes and consideration expressed therein, and in the capacity signed therein stated. for Signed this 3th day of Tuly 2024.  the same  4441 ESHR PAP HOTARL UBLIO MEURG COUR  Mppt  My Commission Expires Nov. 7,2024  My Commission Expires:  Notary Public Mecklonburs Gunb,NC    Colorado Title & Closing Services Durango 970N MainA Ave Durango, CO 81301 (970)247-5464 BUYER(S) CLOSING STATEMENT  FileN Number: $J22103593 Sales Price: $1,500,000.00 Close Date. 12/21/2021 DisbursementDate: 12/21/2021  Type. Purchase Property: 50827,1 TBDI HIGHWAY 550 DURANGO, Co 81301 (SANJUAN) 5985.29..90.,7.13.19.5 50891320130001,7,19,5 55400 C5540) Buyer(s) FIRST CHARLOTTE ESCROW CORPORATION AS QUALIFIEDI INTERMEDIARYFOR MOREHEAD PROPERTY ONE, LLC,A ANORTH CAROLINA! LIMITEDL LIABILITY Seler(s): GRIZZLY PEAKI INVESTMENTS, LLC,AC COLORADOI LIMITEDL LIABILITY COMPANY  COMPANY 1355 Greenwood CI#, Ste. 150 Charlotte, NC2 28204 7170S. BradenA Ave., Ste.2 200 Tulsa, OK7 74136  Description Deposits: Credits. Debits Contad sales pce DapostorE EamestN Money ExthangeFunds Received. Prontions  Debit Credit 5150000000 $150.00000 $1.46622738 1334154 $5237 $20814 $14353 $250423 12407139 $275101 3515478  Courtit lares 14,20211 to1 12/21/2021 $3,13608/ear TradG Conty taxes 11/2021101 12/21/2021 0$5,461 48ear Trac9-1 Courtyt tanes 112021t0 12/21/2021 052.111.78/ear Trac:1 1A Courty lss 112021t01 1221:2021 s.51960ear TradF Courty! laves1 29211012212021 852.674.9 oMaar TradE Courtytaxes1 11232110.12212021 as $352 231.8 S4Mew TrcA-1 Countytaves 11:2021101 1221/2021 52.84680/ear) Tractc Coiry taxes 12921101 12.21:2021 05531495Nes Parcels No.5 5540 Oners coveragas 51,500.000:00F Premum $3,485.00 toColoraco Tdes 3Cbsng Servces Dunrge CWICT DEC- Owners Extended Coverage Survey Coverages MechaniesD Denc Cover duserentg5Co3a6 Tites Setierentor dosng feel Spitiloc Colorado Ties Closng Services Durgo 575000 Expres dalivery service feestoc Colorado Tie ACosng Services- Dvrange $5000 TaxCerficaiento Colorado Tile Closing Services Durango $1.075.00 Excnarges Feelo-Coloraso Tides Closing Services Duanga $10000 WeliF Permit Translerst toColorado Tited Cosirg Senices- Dunnyo $7590 GovarnmantR Recording andT Transfer Charges Recording loes: Deed $4309 Slate Naes Deed$15000 Statement dfAurontyts Simpille $1800 ERecerdigFsetoc Coloraco Tide3 Ciosrg Services Durango $1000 FReENgFwBCaens) Tlego Closing Services- Durargo $10.00 WaterDeed E-Reseraingi Feel loColorado Tdes GClorgs Sarvices Durargo 51900 Additionals Settiement Chargas HOAD DocumenF FTHEC COLUMB:NE GROUPULC 10085 Vembeshginereity nWate: ComparyloGRIZZLYF PEAKY WATER SALES DISTRIBUTION Lsgas SeMicEsIaGREGORY GOLDEN ALAENCVATONEEAYVA Totals  Tille Chargns Cloiny Services Durargo  $3185.00 $7500 575000 55000 $137500 513000 17509 $4300 115300 51800 so00 11000 300 31000 $I0000 $150,00000 13,00000 $1,655,00900 $1.665,00900  Balance Due FROME Borrower:  59.00  FleNumber S.22103593    APPROVED. AND ACCEPTED  BUYERIS) FRSTO CHARLOTTEE ESCROW COAMATOASOMIFEOATBE ROPERTY COVPANY y C ÇNOYS 51 MCCOLLOM VICER FRESDENT REVEMEDAMDAPROVED: MOREMEXOPROPERYONEL LLC, AMOHMCHOIMUMTDSUN COMPANY 9V MCHAELIMILER, MANAGER  FleN Nomber: 3.22103583  202    APPROVED AND ACCEPTED  BUYER/S) FRSTC-ARLOTTEE ESCROWO CORPOBAITONASOIAKIFED: INTERMEDIARYFOR YOREHEADPROPSRIY ONE, LLCA AVOAMOACMLTDUAUN COMPANY BY GINDYSMCCOLLUM VICEPRESIDENT REMEMEDABAPPONED CAMOEEA   TEDLABLITY  FieNumper: $.22103593    SAN JUAN COUNTY RESOLUTION 2024-04  A RESOLUTION REPEALING THE COUNTY IMPROVEMENT AND DEVELOPMENT IMPACT FEE FOR FIRE PROTECTION, RESCUE AND EMERGENCY SERVICES AS ENACTEDINRESOLUTIONNUMBER2022-11,ANDFURTHER TERMINATINGTHE IGA BETWEEN THE COUNTY AND THE DURANGO FIRE PROTECTION DISTRICT WHEREAS, San Juan County (the "County") and the Durango Fire Protection District (the "District") entered into an Intergovernmental Agreement for the Imposition and Collection ofan Impact Fee for Fire Protection, Rescue and Emergency Services on December 15, 2022 (the WHEREAS, the County adopted Resolution Number 2022-11 (the "Resolution") creating said Impact Fees consistent with $29-20-104.5, C.R.S., San Juan County Zoning and Land Use WHEREAS, the Impact Fee IGA and the Resolution were based upon the authority in the prior version of $29-20-104.5, ,C.R.S., which expressly authorized the County,asacondition: ofissuance ofa development permit, to impose an impact fee or other similar development charge to fund expenditures by a fire and emergency services provider that provides fire protection, rescue, and emergency services int the new development on capital facilities needed to serve new development; WHEREAS, SB 24-194, which was adopted by the Colorado General Assembly and signed by Governor Polis on May 22, 2024, deleted the authority oft the County to impose and collect impact fees forentities providing fire protection and emergency services pursuant to 2920-1045,CRS. and authorized the District to impose and collect impact fees directly pursuant to $32-1- WHEREAS, the District has adopted an impact fee schedule in accordance with the requirements of932-1-1000Xd5,. C.R.S., which will become effective August 7,2024; and WHEREAS, the parties have agreed to terminate the Impact Fee IGA as it is no longer necessary. NOW, THEREFORE BE IT RESOLVED by the San Juan County Board of County 1)Resolution Number 2022-11 is hereby repealed in its entirety effective August 7, 2024.  RELATED TOTHATIMPACT FEE  "Impact Fee IGA"); and  Regulations, and the Impact Feel IGA; and  and  1002(1)(d.5), C.R.S., effective August 7, 2024; and  Commissioners:  2) The Impact Fee IGA is hereby terminated effective August 7, 2024.  3) The County will cooperate with the District in providing notice and specifications of building permit applications when received, which will allow applicants to receive notice of Impact Fee amounts from the District early in the process. As required by 32-1-100)d.5XVD. C.R.S., the County will notify the District oft the final issuance ofa County building permit at the time of  issuance, which will trigger collection of the Impact Fee by the District.    APPROVED and ADOPTED the 24thth day ofJuly 2024.  Attest:  Pete Maisel  Scott Fetchenhier  Ladonna L. Jaramillo Clerk and Recorder  Austin Lashley, Chair    PROPERTY TRANSFER AGREEMENT  This Property Transfer Agreement ("Agreement") is dated effective as of 2024 (the "Effective Date"), by and between Sunnyside Gold Corporation, a Delaware corporation, of 5075 S Syracuse Street, Suite 800, Denver, Colorado 80237 ("Transferor") and San Juan County, a political subdivision of the State of Colorado, of 1557 Greene Street, Silverton, Colorado 81433 by and through the Board of County Commissioners of the County of San Juan, Colorado ("Transferee"). Transferor and Transferee are sometimes collectively referred to hereafter as the "parties" and individually, as a "party." All capitalized terms used  herein shall have the meaning ascribed to such term herein.  Recitals:  A. Transferor owns the Property (defined below).  B. Transferor entered into a Consent Decree ("US-CO Consent Decree") with the United States and the State of Colorado ("State"), that was approved on April 29, 2022 by the United States District Court for the District of New Mexico presiding over multidistrict litigation matters centralized in such District, pursuant to the Transfer Order by the United States Judicial Panel on Multidistrict Litigation, In Re: Gold King Mine Release in San Juan County, Colorado, on August 5, 2015, MDL No. 2824, which US-CO Consent Decree C. Pursuant to Paragraph 38.c of the US-CO Consent Decree, on November 8, 2022, Transferor gave the notice required by the US-CO Consent Decree to the U.S. Environmental Protection Agency (EPA) and the State, including the name and address of  includes certain provisions with respect to the Property.  the Transferee.  D. Transferor desires to transfer the Property to Transferee, and Transferee desires to NOW, THEREFORE, in consideration of the mutual promises and covenants, and other good and valuable consideration, the receipt and sufficiency of which is hereby acknowledged,  receive the Property from Transferor, pursuant to this Agreement.  the parties agree as follows: 1. aj part oft this Agreement. 2.  Incorporation of Recitals. The foregoing recitals are incorporated into and made Description of Property. Subject to the terms and conditions oft this Agreement,  Transferor agrees to convey to Transferee, and Transferee agrees to accept from Transferor, all of Transferor's right, title and interest in the real and personal property located in San Juan (a) All of the real property and real property interests owned by Transferor in San Juan County, Colorado, including the real property described on Exhibit A, but specifically excluding any interests of Transferor in rights-of-way, easements, or other access agrementsinstruments that are not appurtenant to the Land, and such excluded interests shall include the rights-of-way, easements and other access agreementsinstruments identified on Exhibit B. The real property and real property interests described on Exhibit A less the excluded non-appurtenant property interests described above to be referred to as the "Land"; (b) All attached buildings and structures and all equipment, fixtures, and other improvements owned by Transferor and located at, or used in connection with the ownership, operation, or maintenance of the Land, including without limitation all  County, Colorado, more particularly described as follows:  Page 1    mechanical equipment and other equipment used in the operation of the Land (c) All of Transferor's right, title, and interest in and to all rights of way, tenements, hereditaments, easements, rights, interests, claims, minerals and mineral rights, water and water rights, utility capacity, common property rights, and appurtenances in any way belonging, or appertaining to the Land and all of Transferor's right, title, and interest in and to all adjoining streets, alleys, private roads, parking areas, curbs, curb cuts, sidewalks, landscaping, signage, sewers, and public ways The Land, Improvements, and Appurtenant Rights described above are collectively referred. to herein as the "Property." All of the Property shall be conveyed, transferred and assigned, as applicable, to Transferee at Closing (defined below) in accordance with this Agreement and the made by Transteror pursuant to this Agreement will be made as a donation to Transferee. Additionally, at Closing, Transferor will donate an additional $20,000.00 (which figure factors in the cost of the updated ASTM required Phase I ESA) in cash or readily available funds (the "Closing Cash Donation") to Transferee in recognition of a portion of the funds expended by  (collectively, Improvements),and  (collectively, "Appurtenant Rights").  documentsagreements contemplated hereby.  3.  Consideration; Donation by Transferor. The conveyance of the Property to be  Transferce for the Phase I (defined below).  4.  Conveyance of Property; Condition of Title.  (a). Quitclaim Deed. At Closing, Transferor shall convey. the Property to Transferee by, quitclaim deed substantially in the form of Exhibit C (the "Quitclaim Deed"; recognizing Exhibit Ci is the form of the deed itself, and does not include its attached Exhibits A and B; such Exhibits shall be substantially the same as Exhibits A and B to this Agreement). (b) Condition ofTitle. Transferee acknowledges that all of Transferor's right, title and interest in and to the Property will be conveyed to Transferee by. quit claim, without representation, warranty or recourse, except as otherwise expressly set forth herein. (c) Additional Documentation. Each party from time to time, subsequent to the Closing, at the other party's request and without further consideration, shall execute and deliver to the other party such other instrument of conveyance, assignment or transfer and take such other action as the other party may reasonably require in order to effectively convey, transfer and  vest and put Transferee in possession oft the Property.  5. Closing; Closing Documents; Closing Fees.  (a) Closing and Closing Date. Closing of the transaction contemplated. by this Agreement shall be conducted through escrow with real estate attorney, Sarah H. Abbott of Ireland Stapleton Pryor & Pascoe, PC ("Closing Attorney"), within 45 days (the "Closing" or "Closing Date"). The time and place oft the closing shall be as agreed upon within 15 days. (b) Closing Deliveries. At or before Closing, Transferor and Transferee, as applicable, shall deliver or cause to be delivered to the other party through escrow. with the Closing Attorney, for recording, filing or delivery, as applicable, the following (collectively, the  "Closing Deliveries"):  (i) The Quitclaim Deed, as previously described in Section 4(a), duly executed and acknowledged by Transferor: and Transferee;  Page 2    (ii) The Closing Cash Donation, and Tax prorations pursuant to paragraph 8 (ii) A certificate prepared and executed by Transferor informing Transferee that Transferor is not a "foreign person" within the meaning of Section 1445 ofthe Internal Revenue Code of 1986, as amended (the "Code"), and regulations issued thereunder, such that withholding of tax is not required  below;  at the Closing;  (iv) The KGUSA Guarantee as provided in Section 17 below;  (v) All other customary and reasonable certificates, title affidavits, documents, Closing instructions, Closing statements, instruments and writings neçessary or desirable to effectuate the transaction contemplated by this Agreement, subject to each party's review and approval of same.  (c) Closing Costs. The Closing Attorney shall record the Quitclaim Deed at Closing. Transferee shall pay any and all fees and expenses related to the Closing including for recording and filing of the Quitclaim Deed and any other Closing Deliveries, and for any Closing Attorney charges. The parties shall pay their own attorney fees for counsel and for review and preparation  of documents prior to Closing:  6. Diligence._  Title-related Materials, Phase I, Inspection, Condition of Property, and Due (a) Title-related Materials. As requested by Transferee, Transferor has provided to Transferee certain title-related materials regarding the Property (the "Title-related Materials"). Transferor makes no representations or warranties regarding the Title-related Materials, and the Transferor's provision of the Title-related Materials does not affect that Transferee is relying on its own due diligence with respect to the Property, Transferee may obtain owner's extended coverage title insurance policy from a Title Company to be issued to Transferee in connection with Closing at Transferee's: sole cost and expense, provided that any such title insurance policy (b) Phase I Assessment. Transferee engaged Iron Woman Construction and Environmental Services, LLC ("Iron Woman") to conduct a Phase I Environmental Site Assessment ("Phase !") on the Land. For the avoidance of doubt, Transferee was the only party that engaged Iron Woman to complete the Phase I. Iron Woman has completed the Phase I. Transferee has provided a copy of the Phase I report to Transferor. Transferee shall be solely responsible for the costs of the Phase 1; provided, however, that Transferor will make a cash donation to Transferee in recognition of the funds expended by Transferee for the Phase I pursuant to Section 3 if this Agreement closes, or pursuant to Section 15 if this Agreement does (c) Inspection by Transferee. In connection with Transferee's right to inspect the Property for the Phase I or other due diligence purposes, Transferee and Transferee's agents, contractors, and consultants have been or shall be allowed access to the Property at all reasonable times for the purpose of conducting any tests, studies, and investigations Transferee deems appropriate, including the Phase I (recognizing the Phase I field work has already been completed as of the Effective Date). Transferee shall not damage, destroy or harm the Property, and any damage or injury caused to the Property by Transferee shall be promptly repaired by Transferee, at Transferee's sole cost and expense, sO as to restore the Property to substantially the condition existing immediately prior to such damage or injury. Transferee shall not permit  shall not delay the timing of Closing.  not close as provided in Section 15.  Page 3    any lien or encumbrance to be filed against the Property as a result of any tests, studies, or investigation. This paragraph shall survive the Closing or termination ofthis Agreement. (d) Condition of Property. Transferee enters into the Agreement in full reliance upon Transferee's independent due diligence, investigation and judgment, and neither Transferor nor Transferor's agents or attorneys make any warranties or representations to Transferee about the Property except as otherwise expressly set forth herein. There are no verbal or other agreements which modify or affect this Agreement. TRANSFEREE AGREES TO ACCEPT THE PROPERTY "AS IS" AND INI ITS PRESENT CONDITION AND STATE OF REPAIR, AND ACKNOWLEDGES THAT TRANSFEROR IS MAKING NO WARRANTIES, EXPRESS OR IMPLIED, WITH RESPECT TO THE CONDITION OF OR TITLE TO THE PROPERTY EXCEPT AS OTHERWISE EXPRESSLY SET FORTH HEREIN. Transferee further acknowledges that Transferor expressly disclaims any warranties of condition, fitness for a particular use or purpose, and all other warranties concerning the Property. The provisions of this paragraph shall survive Closing or termination oft the. Agreement. (e) Due Diligence. Transferee shall have until the date that is thirty days after the Effective Date ("Due Diligence Deadline"),to complete any and all due diligence ofthe Property deemed necessary or appropriate or desirable by Transferee at Transferee's sole cost and expense. Such due diligence may include, without limitation title review, environmental review, surveys, and physical inspections ofthe Property- IfTransferee determines in its sole discretion on or before the Due Diligence Deadline that the Property is unacceptable to Transferee for any reason whatsoever, Transferee may terminate this Agreement by providing written notice to Transferor by the Due Diligence Deadline and this Agreement shall be of no further force and effect except those provisions that expressly survive termination, in which event Transferor shall not be required. to make a donation for any portion of the costs expended by Transferee for the  PhaseI. 7. 8.  Possession. Transferor shall transfer possession of Transferor's interest in the Prorations. Transferor has paid all taxes and assessments on the Property due  Property to Transferee on the Closing Date.  and payable in 2024 for 2023, and all taxes and assessments for all previous years. Transferor shall pay all taxes and assessments. on the Property for 2024 prorated as of the Closing Date based upon the most recent tax and assessment amounts. Tot the extent Transferee is obligated lo pay taxes and assessments on the Property after Closing, Transferee agrees to assume and pay all taxes and assessments on. the Property from and after the Closing Date and for subsequent years.  9.  Representations and Warranties.  (a) Transferor's Representations and Warranties. Transferor represents, warrants, and covenants with Transferee that as of the execution of this Agreement, and which shall be  true and correct as ofthe Closing Date, that  (i) Transferor has full power and authority to enter into this Agreement and to carry out the transaction contemplated by this Agreement. (ii) Transferor has taken all action necessary to authorize its execution and (iii) This Agreement is, and Transferor's other instruments when executed and delivered by Transfcror in accordance with the terms hereof will he, legal, valid. and binding obligations of the Transferor and enforceable in accordance with their terms, except as the same may be affected by  performance of this Agreement.  Page 4    bankruptcy, insolvency, moratorium or similar laws, or by legal or equitable principles relating to or limiting the rights of contracting parties (iv) To Transferor's Actual Knowledge (as defined below) and except for those matters disclosed to Transferee by Transferor as of the Due Diligence Deadline, and except as disclosed in publicly available records or documents, including all such records or documents related to the Bonita Peak Mining District or the US-CO Consent Decree, or as disclosed in the Phase I, or as reflected and disclosed in the Title-related Materials, or known by Transferee to Transferee's Actual Knowledge, no Hazardous Substances (as defined below) exist on the Property in violation of applicable laws. The term "Hazardous Substances' shalll have the same meaning as "hazardous substances" used in the US-CO Consent Decree. As used herein, "Actual Knowledge" means (a) with respect to Transferor, the actual knowledge (without any requirement of investigation other than reviewing this Agreement), as of the Effective Date, and upon Closing as of the Closing Date, of Transferor's current officers, and (b) with respect to Transferee, the actual knowledge (without any requirement ofi investigation other than reviewing this Agreement), as of the Effective Date, and upon Closing as of the Closing Date, of (v) To Transferor's Actual Knowledge and except for those matters disclosed to Transferee by Transferor as oft the Due Diligence Deadline, and except as disclosed inj publicly available records or documents, including all such records or documents related to the Bonita Peak Mining District or the US-CO Consent Decree, or as disclosed in the Phase I, or as reflected and disclosed in the Title-related Materials, or known by Transferee to Transferee's Actual Knowledge, (a) there is no fact or condition currently existing, with respect to the Property or its operation, or any part of it, which violates any law, rule, regulation, ordinance, code, order, decree, or ruling of any local, state,. or federal government, agency, or court, including those matters subject to the US-CO Consent Decree, and (b) Transferor has not received notice, written or otherwise, from any Governmental Authority. (as defined below). currently requiring the correction of any condition with respect to the Property, or any part thereof; and (c) neither the Transferor or the Property is currently a party to or bound by any agreement, stipulation, ruling, decree, injunction, or order which would materially impair Transferee's ability to continue to utilize the Property. As used herein, the term "Governmental Authority" shall mean the United States, the State of Colorado, the County of San Juan, or any other city or county in the State of Colorado, and any agency, department, commission, board, bureau, or instrumentality ofany ofthem. (vi) To Transferor's Actual Knowledge and except for those matters disclosed to Transferee by Transferor as of the Due Diligence Deadline, and except as disclosed inj publicly available records or documents, including all such records or documents related to the Bonita Peak Mining District or the US-CO Consent Decree, or as disclosed in the Phase I, or as reflected and disclosed in the Title-related Materials, or known by Transferee to Transferee's Actual Knowledge, Transferor is not aware of any agreements which give a third party rights to enter and use the surface of  generally.  Transferee's current officials or commissioners.  the Property to access water on the Property.  Page 5    (vii) To Transfror's: Actual Knowledge and except for those matters disclosed to Transferee by Transferor as of the Due Diligence Deadline, Transferor knows of no claim of right, easements, or other rights of third parties affecting the Property (including without limitation any, rights, easements, liens, rights of first refusal, options, or other rights of third parties not shown by public records), other than those matters disclosed in publicly available records or documents including all such records or documents related to the Bonita Peak Mining District (as defined as the Site in the US-CO Consent Decree) or the US-CO Consent Decree, or as disclosed in the Phase I, or as reflected and disclosed in the Title-related Materials, or known by Transferee to Transferee's Actual Knowledge. (viii) To Transferor's Actual Knowledge and except for those matters disclosed to Transferee by Transferor as of the Due Diligence Deadline, and except as disclosed in publicly available records or documents, including all such records or documents related to the Bonita Peak Mining District or the US-CO Consent Decree, or as disclosed in the Phase I, or as reflected and disclosed in the Title-related Materials, or known by Transferee to Transferee's Actual Knowledge, there are no leases currently in effect with respect ton any portion of the Property, and no tenant under any current lease or other agreement is entitles to any free rent, concessions, allowances. rebates or refunds and no tenant has an option to purchase the  Property or any portion thereof.  (b) Transfèree's Representations and Warranties. Transferee represents, warrants, and covenants with Transferor that as of the execution ofthis Agreement, and which shall be true and correct as of the Closing Date, that (i) Transferee has full power and authority to enter into this Agreement and to carry out the transaction contemplated by this Agreement; (i) Transferee has taken all action necessary to authorize its execution and performance oft this Agreement; and (iii) this Agreement is, and Transferee's other instruments when executed. and delivered by Transferee in accordance with the terms hereof will be, legal, valid and binding obligations of thc Transferce and enforceable in accordance with their terms, except as the same may be affected by bankruptcy, insolvency, moratorium or similar laws, or by legal or equitable (c) The representations and warranties set forth in this Section 9 will survive the Closing of the transaction contemplated by this Agreement for a period of three years after Closing and shall not merge into the terms ofany deed or other instrument of conveyance. (d) Transferor shall have no liability with respect to a claim or claims under Section 9(a) unless the total of claimed damages with respect to such matters exceeds $20,000.00, and then only for the amount by. which such damages exceed $20,000.00, and provided further that the amount of any individual claim must exceed $2,500.00. Furthermore, in no event shall Transferor's maximum aggregate liability for damages for claims under Section 9(a) exceed  principles relating to or limiting the rights of contracting parties generally.  $3,000,000.00.  10. Post-Closing Covenants and Obligations ofTransferee. (a) Assumption of Obligations and Liabilities.  Page 6    (i) Obligations ofUS-CO Consent Decree. As ofand after the Closing Date, Transferee agrees to fully assume, comply with, and be bound by, all provisions of Section XII of the US-CO Consent Decree applicable to Transferor and the related penalty provisions of Paragraph 11.b ofUS-CO Consent Decree, and requirements for subsequent conveyances by Transferee more fully set forth in Section 10(d) oft this Agreement. As of and after the Closing Date, Transferor shall be relieved of any and all of its obligations under Section XII and related penalty provisions of Paragraph 11.b of the US-CO Consent Decree, and shall take no further actions under or otherwise related to Section XII of the US-CO Consent Decree, including for any future response actions referenced in Paragraph 36 in Section XII of the US-CO Consent Decree or institutional controls referenced in Paragraph 37 in Section XII ofthe US-CO Consent Decree, (ii) Other Post-Closing Obligations and Liabilities. As of and after the Closing Date, Transferee agrees to assume and be responsible for any and all obligations and liabilities, of any kind, character or nature, related to the Property and arising from any. matters relating to the Transferee's ownership, use or non-use of, or actions or failures to act with respect to, the Property after the Closing Date, including any such liability or obligations under Environmental Laws (defined below) related to the Property. In connection with Transferee's assumptions herein, Transferee expressly acknowledges and understands that the Property may have been mined or operated or used as sites for tailings or other waste and refuse disposal and as such, may be subject to statutes, laws, regulations, permits or orders imposing obligations in connection therewith (collectively, the  at or related to the Property.  "Environmental Laws").  (b) Release and Covenant Not to Sue by County. As of Closing and as to the Property being acquired by Transferee, on behalf of itself and its successors and assigns, Transferee hereby releases any and all claims it may have, now or in the future, against Transferor and Transferor's Affiliated Parties (as defined below) (collectively, the "Released Parties"). with respect to (i) any matters arising from or related to the Bonita Peak Mining District Site arising or accruing after the Closing Date, (ii) any matters relating to the Transferee's ownership, use or non-use of, or actions or failures to act with respect to, the Property, after the Closing Date, including the environmental or physical condition of the Property, and (iti) all matters addressed in the US-CO Consent Decree. To the maximum extent permitted by law, Transferee fully and forever covenants not to sue or to institute or cause to be instituted any action in any federal, state or local agency. or court against the Released Parties for indemnification or otherwise regarding any claims or matters released by Transferee in this Agreement and any obligations and liabilities assumed by Transferee under this Agreement. "Transferor's Affiliated Parties" shall mean the Transferor, any assignee of Transferor, any Affiliate (as defined below) ofTransferor, and all of their respective owners, directors, agents, officers, and employees. "Affiliate" means any entity, that directly or indirectly through one or more intermediaries, controls, is controlled by, or is under common control with the subject (ç) Termination and Release of Existing Contractual Liabilities. Pursuant to that certain Land Exchange and Consolidation Agreement dated May 29, 2007 (the "2007 Agreement"), by and between Transferor and Transferee, the Transferee agreed to and thereafter quitclaimed to Transferor its interests in Eureka Parcels 1-6, located within the abandoned Eureka Townsite (collectively, the "Eureka Parcels") (which such parcels are to be re-conveyed by Transferor to Transferee pursuant to this Agreement), subject to certain indemnification  entity or entities.  Page 7    obligations ofTransferor in favor of Transferee for and related to the Eureka Parcels, as set forth in Section 9 of the 2007 Agreement. By Closing under this Agreement, Transferee hereby terminates and fully and forever releases Transferor from the indemnification obligations of Transferor under the 2007 Agreement with respect to the Eureka Parcels and agrees that such indemnification obligations ofTransferor shall be null, void and ofno further force or effect after (d) Future Conveyances. Transferee agrees that in any subsequent conveyance. of all or any portion of the Property, or any interest in the Property (including without limitation any grant of an easement burdening any of the Property or any. grant ofa lease of all or any part of the Property), Transferee shall include the following provisions in the deed or other conveyance instrument, and include applicable dates and recording information for the Quitclaim Deed from  Closing.  Transferor to Transferee:  Grantee hereby agrees to (i) accept the property subject to the covenants, obligations and responsibilities set forth in that certain Quitclaim Deed (ii) abide by and enforce the covenants and assume, undertake and perform the obligations and responsibilities as the owner of property in accordance with the terms and conditions of such Quitclaim Deed. Grantee hereby further agrees to be bound by the release and covenant not tosue provisions set forth in the foregoing Quitclaim Deed. Grantee hereby further agrees that in any subsequent deed or other conveyance instrument, it shall require that the grantee in such deed or conveyance instrument to either (i) execute a deed or conveyance instrument which contains the agreements seti forth in the immediately preceding paragraph, or (ii), execute a separate acknowledgment attached to the deed or conveyance instrument which contains the agreements set (e) Survival. All covenants and agreements of Transferee in this Section 10 shall 11. Operation of Property Pending Closing; Risk of Loss. From and after the Effective Date through the Closing Date, Transferor and Transferor's agents shall, at (a) Keep in existence all property and liability insurance policies, and any other applicable insurance policies, that are in existence as of the date oft this Agreement with respect (b). Not enter into any transaction with respect to or affecting the Property that would (c) Not sell, encumber, lease or grant any interest in the Property, or any part thereof, in any form or manner whatsoever or otherwise perform or permit any act that would prevent (d). Subject to Section 8 concerning prorations, pay all taxes and assessments levied against or incurred in connection with the ownership or operation of the Property, as such taxes  dated as of #  2024, and recorded on  2024, as Document  in the real property records of San Juan County, Colorado and  forth in the immediately preceding paragraph.  survive Closing and continue until such covenant or agreement is performed in full.  Transferor's expense: to the Property;  affect or bind Transferee after the Closing Date;  Transferor's full performance ofi its obligations hereunder; and  and assessments become due and payable.  Page 8    12. Conditions Precedent. The parties' respective obligations to consummate the transaction contemplated by this Agreement are each subject to, and conditioned upon, the (a). Accuracy of Representations. All representations and warranties of the parties contained in this Agreement shall be true and correct in all material respects on, and as of, the (b). Fulfillment of Covenants. The parties shall have each performed and complied in all material respects with all ofi its respective covenants, agreements, and obligations hereunder. (c) Delivery of Documents. Delivery by parties of their respective Closing Deliveries and any other documents and instruments of transfer and assignment necessary or desirable to 13. Satisfaction or Waiver of Conditions. In the event that a condition or provision set forth above or any, other condition to Closing stated int this Agreement fails to occur, the party benefited by, the condition shall have the right either to (i) terminate this Agreement and this Agreement shall be of no further force and effect except those provisions that expressly survive termination, or (ii) waive such failed condition or objection and proceed to close this transaction. 14. Risk of Loss and Damage. Transferor assumes all loss or damage to the Property by any cause through the Closing Date. Ifany loss, casualty or other occurrence shall have taken place, whether or not covered by insurance, or the Property (in whole or in part) becomes subject to condemnation or eminent domain proceedings, Transferor shall promptly give notice thereof to Transferee. After such notice is given, then Transferee, at Transferee's sole option, shall have no obligation to accept the conveyance of the Property on the Closing Date, unless such loss or damage is fully repaired or restored on or before the Closing Date or, if not fully repaired or restored, is covered by insurance in an amount satisfactory to Transferee (in its sole discretion) and the proceeds of such insurance are assigned or delivered to Transferee at Closing. Notwithstanding the preceding sentences of this Section 14, Transferee shall not be entitled to terminate this Agreement pursuant to this paragraph if the loss or damage resulting in amaterial adverse impact on the Property or its use is caused by the negligent or intentional acts or omissions ofTransferee or Transferee's s officers, employees, agents, contractors, or invitees. 15. Remedies. The parties shall have the following remedies upon default: (a) Transferee' s Remedies. IfTransferor fails to close pursuant to this Agreement in accordance with its terms for any reason, Transferee shall have as Transferee's sole remedy the  satisfaction oft the following conditions on or before the Closing Date:  Closing Date.  consummate the transactions contemplated by this Agreement.  option of either oft the following:  (i) Terminate this Agreement by. giving written notice to Transferor in which case all of the obligations of the parties hereunder shall terminate without liability of any party to any other party except those provisions that expressly survive termination, in which event Transferor shall, within thirty (30) days of such termination, make a donation to Transferee in the amount of $19,700 in recognition of the funds expended by Transferee for (ii) Enforce the Transfèror's specific performance of Transferor's obligations  the Phase I; or under this Agreement.  Page 9    (b) Transferor's Remedies. IfTransfèree fails to close pursuant to this Agreement in accordance with its terms for any reason, Transferor shall have as Transferor's sole remedy the  following:  (i) Terminate this Agreement by giving written notice to Transferee in which case all of the obligations of the parties hereunder shall terminate without liability of any party to any other party except those provisions that expressly survive termination, in which event Transferor shall not be required to make a donation for any portion of the costs expended by  Transferee for the Phasel.  (c) Mutual Termination. If the transaction contemplated by this Agreement fails to close through no fault of either party, despite mutual good faith negotiations and efforts, the parties may mutually agree in writing to terminate this Agreement without liability of any party to any other party except those provisions that expressly survive termination, in which event Transferor shall, within thirty (30) days of such termination, make a donation to Transferee in the amount of $20,000.00 (which figure factors in the cost of the ASTM required PhaseIESA update) in recognition ofa portion of the funds expended by Transferee for the Phase I.  16. Notices.  (a) All notices or deliveries required or permitted under this Agreement shall be in writing and shall be hand-delivered, given by certified mail, return receipt requested or overnight courier, or sent by email to the party to be served at such email address set forth in this Agreement or supplied by each party to each other. A copy of such notice or other (b) All notices sO given shall be considered effective: (i) if hand-delivered, when received; (ii) if delivered by courier, one (1) business day after timely deposit with the courier service; charges prepaid; (in) if mailed, three (3) days after deposit, if postage prepaid, with the United States Postal Service; and (iv)ifdelivered by email, upon deposit ofthe message, as sent, (c) Either party may, change the address to which future notices shall be sent by notice given in accordance with this paragraph. Each party's attorney may: send or receive notices at the direction of and in place of the respective party such attorney represents. (d) Notices or deliveries required or permitted under this Agreement shall be sent to  communication shall also be sent to each party's attorneys.  int the sender's email box.  the parties and their respective attorneys at the following addresses:  Ifto Transferor:  Sunnyside Gold Corporation Attn: General Counsel 5075 S Syracuse Street, Suite 800 Denver, Colorado 80237 legiNotices@kimos.com Crowley Fleck PLLP Attn: Neil G. Westesen 9001 N. Last Chance Gulch Suite 200 Helena, MT 59601 nwestesen@crowleytleck.com San Juan County  With a copy to:  Ifto Transferee:  Page 10    Attn: Dennis Golbricht 1557 Greene Street Silverton, Colorado 81433 demns@animaslaw.om Rebecca Almon Ireland, Stapleton, Pryor & Pascoe, P.C. 1660 Lincoln Street, Suite 3000 Denver, CO 80264 ralmon@irelandstapleton.com  With a copy to:  17. Corporate Guarantee/Financlal Assurance. Transferor shall take necessary action to cause its indirect corporate parent Kinross Gold U.S.A., Inc. ("KGUSA") to execute and provide at Closing, in a form that is commercially reasonable and acceptable to Transferee and KGUSA, a corporate guarantee on behalf of Transferor, guaranteeing the obligations and liabilities of Transferor hereunder ("KGUSA Guarantee"). The KGUSA Guarantee shall be maintained for three years after the Closing Date, at which time KGUSA's obligations under the KGUSA Guarantee shall terminate, and the KGUSA Guarantee shall be subject to the dollar limitations in Section Sections 9(d) and 18 herein, and in no event shall KGUSA's maximum  aggregate liability under this paragraph exceed such dollar limitations.  18. Non-CERCLA Liability. Transferor shall defend, indemnify, and hold harmless Transferee, and Transferee's managers, officers, commissioners, administrators, employees, attorneys, agents, and representatives (collectively Indemnified Parties"), as applicable, from and against all private, non-CERCLA third-party claims, demands, or causes of action (collectively "Claims"), and losses, costs, damages, expenses and liabilities which any Indemnified Party may suffer, sustain or become subject to, as a result of Claims made against any Indemnified Party by Eureka Gulch Properties LLC, its member Ryan T. Bennett or its successors in interest to the Eureka Gulch Properties (defined below) associated with the property interest currently held by Eureka Gulch Properties LLC in the following patented mining claims associated with the Whiton Agreement (defined below): Adventure MS 14443, Iron Mask MS 14443, Benjamin Franklin MS 1011, and Hidden Hand MS 1658, (collectively "Eureka Gulch Properties"), provided such Claims are based on (a) Transferee's post-Closing ownership in the following patented mining claims currently owned by Transferor, which are part of the Property: Thunderberg MS 1395, Last Chance MS 17901 and Bavarian MS 1396 (collectively the "SGC Terry Tunnel Area Properties" and collectively with the Eureka Gulch Properties the "Terry Tunnel Area Properties"), including the presence on or beneath the Terry Tunnel Area Properties of any Hazardous Substances caused by Transferor's pre-Closing activities, any Hazardous Substances which have been released from the Terry Tunnel Area Properties as a result of Transferor's pre-Closing activities, or any pre-Closing violation by Transferor ofany Environmental Laws on the Terry Tunnel Area Properties; provided further that the indemnity obligations of Transferor provided in this paragraph shall only apply to the current condition of the Terry" Tunnel Area Properties or to Transferor's pre-Closing activities on the Terry Tunnel Area Properties, and Transferor shall have no indemnity obligation for any post-Closing activities by Indemnified Parties or any third party on the Terry Tunnel Area Properties; and provided further that the indemnity obligations of Transferor provided in this paragraph shall survive the Closing of the transaction contemplated by this Agreement for a period of three years after Closing, and in no event shall Transferor's maximum aggregate liability for the indemnity obligations in this  Page 11    paragraph exceed $3,000,000.00. In the event Transferee seeks indemnification for a Claim under this paragraph, Transferee shall inform Transferor of such Claim as soon as reasonably practicable after Transferee receives notice of such Claim, and Transferee shall permit Transferor to assume direction and control of the defense of such Claim (including the right to settle such Claim solely for monetary consideration with no admission of fault), and Transferee shall cooperate as requested (at the expense ofthe Transferor) in the defense ofs such Claim. The following capitalized terms used in this paragraph have the following definitions or meaning: "CERCLA" as defined in the US-CO Consent Decree; "Whiton Agreement" means the instrument between William H. Whiton and John B. Terry concerning the Terry Tunnel, executed on October 12, 1905, and recorded with the San Juan County Recorder on January 6, 1906 at Book 127, Page 284; "Hazardous Substances" as defined in Section 9(a)(iv) herein; and  "Environmental Laws" as defined in Section 10(a)(ii) herein.  19. Miscellaneous.  (a) No Construction Against Drafting Party. This Agreement shall not be construed more strictly against one party than against the other merely by virtue of the fact that the Agreement may have been prepared primarily by counsel for one of the parties, it being recognized both parties and/or their counsel have contributed substantially and materially to the  preparation oft this Agreement.  (b). Time is oft the Essence. Time of payment and performance shall be of the essence (c) Attorney Fees. In any action brought by the Transferee or Transferor to enforce any of the terms of this Agreement, the substantially prevailing party in such action shall be (d) Entire Agreement. This Agreement (including the Exhibits hereto). contains the entire agreement and understanding of the parties concerning the conveyance of the Property, and supersedes any and all prior negotiations and understandings. All Exhibits attached hereto: are incorporated herein by this reference for all purposes. This Agreement shall not be modified, amended or changed in any respect except by a written document signed by: all parties hereto. (e) Captions. The captions, titles and section headings throughout this Agreement are for convenience and reference only and shall not be deemed or held to explain, modify, amplify ora aid in the interpretation, construction or meaning of the provisions of this Agreement, nor to (f) Successors and Assigns; No Third-Party Benefit. The terms, covenants and conditions of this Agreement shall be binding upon, and shall inure to the benefit of, the parties hereto and their respective successors and permitted assigns. Subject to the provisions herein regarding Transferor's Affiliated Parties and Released Parties, and regarding Indemnified Parties, this Agreement is for the sole benefit of Transferor and Transferee (including an assignee), and no third party (including, without limitation, any real estate broker or any subsequent owners of the Property) is intended to be a beneficiary of or have the right to enforce (g) Nonwaiver. No waiver of any condition expressed in this Agreement shall be implied by any neglect of Transferee or Transferor to enforce any remedy on account of the violation of such condition, whether or not such violation be continued or repeated subsequently;,  ofe each and every provision oft this Agreement.  entitled to such reasonable attorneys' fees as the court shall determine just.  define, limit or describe the scope or intent ofaj particular section.  this Agreement.  Page 12    and no express waiver shall affect any condition other than the one specified in such waiver for (h) Survival of Terms. Subject to Sections 9(c), 17, and 18, all express representations, warranties, and continuing obligations made in or given in this Agreement will survive the Closing of the transaction contemplated by this Agreement or the expiration or the termination of this Agreement for any reason, and such express representations, warranties, and continuing obligations shall not merge into the terms of any deed or other instrument of (i) Governing Law. This Agreement and any disputes arising hereunder shall be governed hereafter and construed and enforced in accordance with the laws of the State of Colorado, including any applicable Colorado constitutional provisions, without reference to principles of choice or conflicts of laws. Any claim or dispute arising out of or related to this Agreement, or the enforcement or interpretation hereof shall be brought solely and exclusively in ac court of competent jurisdiction in Colorado; Transferor and Transferee consent and submit to any number of counterparts, all of which when taken together will constitute one and the same instrument. A counterpart signed and delivered by electronic means in pdf, tiff, or jpeg file (k) Invalid Provisions: Severability. Ifany provision of this Agreement (except those provisions relating to Transferor's obligation to convey the Property and Transferee's obligation to receive the Property subject to the post-Closing obligations and covenants set forth in Section 10(a)(i), the invalidity of either of which shall cause this Agreement to be null and void) is held tol bei illegal, invalid or unenforceable under present or future laws, such provision shall be fully severable; this Agreement shall be construed and enforced as if such illegal, invalid or unenforceable provision had never comprised a part of this Agreement; and the remaining provisions of this Agreement shall remain in full force and effect and shall not be affected by the illegal, invalid or unenforceable provision of by its severance from this Agreement. (I) Governmental Immunity. Nothing in this Agreement is intended to be, and shall not be construed as, a waiver of the limitations on damages or any, oft the privileges, immunities, or defenses provided to, or enjoyed by, the Transferee, or its directors, officers, employees, volunteers, or agents, under common law or pursuant to statute, including but not limited to the (m) Transferee acknowledges that Transferor may pursue treating the donation of the Property as a charitable donation for federal tax purposes, and Transferee agrees to cooperate before Closing or after Closing as reasonably requested by Transferor with respect to such charitable donation, including signing IRS Form 8283 as required for such charitable donation.  the time and in the manner specifically stated.  conveyance.  thej jurisdiction ofs such courts.  0)  Counterparts. This Agreement (and any amendment hereto) may be executed in  format shall be as valid and effectual as the original of that counterpart.  Colorado Governmental Immunity Act, C.R.S. $ 24-10-101, etseq.  signature page follows immediately)  Page 13    IN WITNESS WHEREOF, the parties have signed this Property Transfer Agreement on  the date set forth opposite their respective signatures.  Dated:  Sunnyside Gold Corporation, al Delaware  corporation By: Name: Title:  "Transferor"  Dated:  San Juan County, a political subdivision of the State of Colorado, by and through the Board of County Commissioners of the County of San  Juan, Colorado By: Name: Title:  Transteree"  Page 14    Exhibit A Description ofLand  The following real property is located in Township 42 North, Range 6 West, Township  421 North, Range 7 West, and Township 41 North, Range 7 West, N.M.P.M.  Description/Claim Name and Mineral Survey No.  Property Tax Parcel ID  EUREKA TOWNSITE LOT5 5 ACCORDING TO THE RECORDED BOUNDARY. ADJUSTMENT THEREOF FILED FOR RECORD: SEPTEMBER 30, 2011 AS EUREKA TOWNSITE LOT 61 ACCORDING TO THE RECORDED BOUNDARY ADJUSTMENT THEREOF FILED FOR RECORD SEPTEMBER 30, 2011 AS CASHIER LODE - MS 134 (UND 9/10 INTI IN 10.5 ACRES), CENTENNIAL MS 16635, NASBY-MS 2508, ROVING RANGER LODE-MS151A, TAGNER- MS 16804, WHITE STAR- - MS 14368 EUREKA TOWNSITE LOT1A ACCORDING TO THE RECORDED BOUNDARY ADJUSTMENT THEREOF FILED FORI RECORD SEPTEMBER 30, 2011 AS EUREKA TOWNSITE LOT2 ACCORDING TO THE RECORDED BOUNDARY ADJUSTMENT THEREOF FILED FOR RECORD SEPTEMBER 30, 2011 AS EUREKA TOWNSITE LOT3A ACCORDING TO THE RECORDED BOUNDARY, ADJUSTMENT THEREOF FILED FOR RECORD SEPTEMBER 30, 2011 EUREKATOWNSITE LOT 4/ ACCORDING TO THE RECORDED BOUNDARY, ADJUSTMENT THEREOF FILED FOR RECORD SEPTEMBER 30, 2011 CASHIER- MS 442, ORIENTAL MS 566, PRIDE OF EMMA- MS 2273, LULU CARROLL- MS 873, MOTHER GOOSE MS 17234, MOULTRIE LODE- MS 173, PAYMASTER- MS 1301, PONY MS2 2336 (UND 2/3 INT IN 8.10 ACRES) MIDNIGHT MS 5616 TAGGART MS 2338 (UND 1/3 INTI IN7.22 ACRES) PALOS MS 18732, PALOS #1 - MS 18732, PALOS  #47730190030005  RECEPTION #148168  #47730190030006  RECEPTION #148168  #47730190050004  #47730300020001  RECEPTION #148168  #47730300020002  RECEPTION #148168  #47730300020003  #148168  #47730300020004 #47750090050001  #148168 THE ALPS- MS572  #47750100050003 #47750100050031 #47750100050051 #47750110050002  Page 15    #2- - MS 18732, SUNNYSIDE #2- MS 20003, SUNNYSIDE EXT- MS 1180, TERRY MS 17986, MASTODON MS216, NOI NAME - MS2 2272, CROWN. JEWEL MS 20003, DOCTOR MS 2093 A, ESMARALDA: - MS 16165, GOLD PRINCE- MS MUSKEGON MS: 1394, RARUS MS1401, NANTUCKET MS 6954 (UND 5/12 INT IN 10.28 ACRES), DENVER- - MS 1403, ALMA MS 1708, CLIMAX #3 - MS 19474, TIP TOP-I MS 18108, TIP TOP! #2- - MS 19474, TIP TOP #3 -MS 19474 REPUBLIC MS 12724, RUBY- MS 18020, SHOSHONE MS 17201, SILVER BOW- - MS 18020, SUNNYSIDE MS 438, SUNNYSIDE ANNEX- MS 16668, THUNDERBERG MS 1395, WEDGE MS 18160, ANACONDA - MS 18020, BAVARIAN- MS 1396, BRIGGS MS 8400, BUTTE CITY MS 18020, CLIMAX- MS 12723, CLIPPER- MS 1689, HERMAN MS 1397, HIDDEN TREASURE EXT- MS 20003, LAKE MS 2027, LAST CHANCE- MS 17901, LITTLE MARY MS 2038, METROPOLIS- MS 1398, PEARL - MS 5975, QUAIL-N MS 20003, GEORGE WASHINGTON - MS 2028, GRAND' VIEW MS 17202, MOUNTAIN SHEEP- MS1 17432, HONECK: MS 16200, SILVER KING MS 1857 PAYMASTER - MS 18080, WATERLOO MS 17429 EMMA #1 MS 17538, EMMA #Z- MS 17538, AMA- -MS: 18849, BLUE HEEL MS 18849, DOVER MS 1690, GOLD PEAK- MS 16393, JOE-N MS 18849, MILANO - MS 16393, RED MS 18849, ROCK MS 18849, ROSA- MS 18849, ROSSO- - MS 18849, ROUENA 0- MS 16393, TREASURE MS 18849, YANKEE BOY- MS 18849 BEAUBREC- MS 1709 ADSEARL- MS 1714, DANEBURG MS 1780, HILDERBRAND - MS 1707, KNICKERBOCKER- - MS 1717, UNDERWOOD MS 1719 BLUCHER. MS 1400, EIGHTY NINE MS 16997, ESTEY- MS 13189, LIZZIE NORRIS I MS1702, GRAND - MS 2573, GRAND PRIZE - MS1701, GREAT EASTERN MS 1691, NEW YORK MS 8399, WELLINGTON- MS 16997, SUNBEAM- MS  20003 FEARLESS - MS17011  #47750110050022  #47750130050001 #47750130050003  CHARLTON MS 1706  #47750140050002 #47750150050001 #47750150050002 #47750150050011 #47750160050006  RAYMOND MS 18020 OREGON MS 17233  SMUGGLER- MS 1758  #47750220050003 #47750230050001 #47750230050002 #47750240050001  Page 16    1419  BENDI PLACER- MS 11596, CHI MILL SITE-MS 20594. FORMERLY PART OF SCHEDULE SUNNYSIDE GOLD CORPORATION- PERINO BOUNDARY ADJUSTMENT PARCEL C, RECORDED ASI RECEPTION NO. 151146, IN SUSPENDED T41N R7W. FORMERLY PART OF ANNI HARRIS PLACER- MS 11596 AND FORMER PARCEL BB, RECORDED AS RECEPTION NO. 186140. FORMERLY PARTOF SCHEDULES 48290090010003. AND 48290090010036. SUNNYSIDE GOLD CORPORATION- PERINO BOUNDARY, ADJUSTMENT PARCEL E, RECORDED AS RECEPTION NO. 151146, IN SUSPENDED T41N R7W. FORMERLY PORTIONS OF MI DTHATCHER MS 17699. ANDI POLAR: STAR MILL SITE- MS 7608. FORMERLY PART OF SCHEDULE 48290090010031 SUNNYSIDE GOLD CORPORATION- PERINO BOUNDARY ADJUSTMENT PACEL F, RECORDED AS RECEPTION NO. 151146, IN SUSPENDED T41N R7W. FORMERLY PART OF PETER PLACER- MS 11596, AND: SMALL PORTIONS OFI MD THATCHER MS 17699. ANDI BLM TRACT 41. FORMERLYPART OF SCHEDULE 48290090010031 AND 48290090010032. BLAIR PLACER MS 841, GOLD MS 14012, JEANNETTE ROUX PLACER MS 11596 MINERAL RIGHTS ONLY, RIVERSIDE (PART)- MS 8801, HVB MILL SITE MS 20594 B. FORMERLY PART OF SCHEDULE 48290090010003 TRACTS 42, 43, 44, 45, ANDI PARCEL DD IN T41N BUENA VISTA MS 14012, MI B MILLSITE- MS 20595 B, NI N MILLSITE- MS 20595 B,THWMS TRACT A MS 20595 B, THY WMSTRACTB-MS  #48290090010033  48290090010031  #48290090010039  #48290090010041  AND 48290090010032.  #48290090010042  #48290090010043 #48290090010044  R7W  48290100010006  20595 B  Page 17    Exhibit B  Excluded Rights-Of-Way, Easements and Other Access Agrementylnstruments Any and all existing rights and obligations identified in the following:  1. Land Use Permit (COC-80047) issued by the United States Department of Interior, Bureau ofLand Management to the Sunnyside Gold Corporation. 2. Right-of-Way Temporary Use Permit (COC-077429) issued by the United States Department of Interior, Bureau of Land Management to the Sunnyside 3. Access Easement from Larry R. Perino to the Sunnyside Gold Corporation, 4. Easement Agreement between Frank Baumgartner, Sial Exploration Inc., and Osiris Gold, Inc. and the Sunnyside Gold Corporation, dated November 4, 2002, recorded January 16, 2003, in the records of the Clerk and Recorder of 5. Access Agreement between the Sunnyside Gold Corporation and Jack 6. Access Agreement between the Sunnyside Gold Corporation and Le Roy W. 7. Access Agreement between the Sunnyside Gold Corporation and Jeff and 8. Access Agreement between the Sunnyside Gold Corporation and the Silverton 9. Access Agreement between the Sunnyside Gold Corporation and Houghton 10.4 Access Agreement between the Sunnyside Gold Corporation and Delmar E. 11.Access Agreement between the Sunnyside Gold Corporation and Thomas J.&  Gold Corporation. dated July 12, 2017.  San Juan County as Document No. 142337. Brendlinger, dated October 18, 2020. Goodwin II, dated October 12, 2020. Jerry Sandberg, dated October 5, 2020.  Lakes RV Resort LLC, dated September 29, 2020. Unlimited LLC, dated September 14, 2020. Calhoun, dated August 31, 2020.  Jean L. Merson Revocable Trust, dated August 31, 2020.  Page 18    12. Access Agreement between the Sunnyside Gold Corporation and the San 13. Access Agreement between the Sunnyside Gold Corporation and Mace L. and 14. Access Agreement between the Sunnyside Gold Corporation and the Paul H. & Nancy Painter Trust, clo Gregg Painter, dated August 8, 2020. 15.A Access Agreement between the Sunnyside Gold Corporation and Lisa D. and 16.Access Agreement between the Sunnyside Gold Corporation and GrayJay 17.Access Agreement between the Sunnyside Gold Corporation and Charles 18. Access Agreement between the Sunnyside Gold Corporation and Tim A. 19.Access Agreement between the Sunnyside Gold Corporation and the 20. Access Agreement between the Sunnyside Gold Corporation and Larry 21. Access Agreement between the Sunnyside Gold Corporation and Loren Lew, 22. Access Agreement between the Sunnyside Gold Corporation and Mi Casa es Su Casa and Dan Dugi Defined Benefit Trust, dated November 1, 2019. 23.Access Agreement between the Sunnyside Gold Corporation and Michael K. 24.Access Agreement between the Sunnyside Gold Corporation and Ryan and 25. Access Agreement between the Sunnyside Gold Corporation and the San Juan  Miguel Power Association, dated August 30, 2020. Cheryl L. Pemberton, dated August 21, 2020.  Shawn W. Merrill, dated August 7, 2020. Meadows LLC, dated August 7,2020. Jacob Csira, dated November 1, 2019.  Edgar and Pam Killebrew, dated November 1,2019. Katherine Smith Trust, dated November 1,2019.  Perino, dated November 1, 2019. dated November 1, 2019.  Meuer, dated November 1,2019.  Cherie Naffzinger, dated November 1,2019.  County Historical Society, dated November 1,2019.  Page 19    26. Access Agreement between the Sunnyside Gold Corporation and the Sidehill 27. Access Agreement between the Sunnyside Gold Corporation and Vernon & 28. Access Agreement between the Sunnyside Gold Corporation and ZLM LLC, 29. Access Agreement between the Sunnyside Gold Corporation and the San Juan County Historical Society, executed on January 1, 1999. 30. Access Agreement between the Sunnyside Gold Corporation and the San Juan County Historical Society, executed on September 15, 1998. 31. Access Agreement between the Sunnyside Gold Corporation and Aerodium 32. Access Agreement between the Sunnyside Gold Corporation and Glen E. 33. Access Agreement between the Sunnyside Gold Corporation and ASARCO, 34. Access Agreement between the Sunnyside Gold Corporation and TUSCO, Joseph Baldwin, and Michael Combs, dated November 6, 1996, recorded November 21, 1996, in the records of the San Juan County Clerk and  Mugwump Protection Society, dated November 1,2019. Amanda Bridgewater, dated November 1,2019.  dated November 1,2019.  Inc., executed on March 31, 1997.  Nordlander, executed on March 31, 1997. Inc., dated November 8, 1996.  Recorder as Document No. 138422.  Page 20    Exhibit C Form of Quitclaim Deed  After recording, return to: San. Juan County Attn: 1557 Greene Street Silverton, Colorado 81433  QUITCLAIMDEED  Sunnyside Gold Corporation, a Delaware corporation, with a mailing address of 5075 S Syracuse Street, Suite 800, Denver, Colorado 80237 ("Transferor"), hereby conveys, remises, releases, and quitclaims unto San Juan County, Colorado, a political subdivision of the State of Colorado, by and through the Board of County Commissioners of the County of San Juan, Colorado, whose address is 1557 Greene Street, Silverton, Colorado 81433 ("Transferee"), all of Transferor's right, title and interest in the real and personal property located in San Juan County,  Colorado, more particularly described as follows:  (A) All of the real property and real property interests owned by Transferor in San Juan County, Colorado, including the real property described on Exhibit A, but specifically excluding any interests of Transferor in rights-of-way, easements, or other access grementsimstruments that are not appurtenant to the Land, and such excluded interests shall include the rights-of-way, easements and other access agreements/ instruments identified on Exhibit B. The real property and real property interests described on Exhibit A less the excluded property interests (B) All attached buildings and structures and all equipment, fixtures, and other improvements owned by Transferor and located at, or used in connection with the ownership, operation, or maintenance of the Land, including without limitation all mechanical equipment and other equipment used in the operation of the Land (C) All of Transferor's right, title, and interest in and to all rights of way, tenements, hereditaments, easements, rights, interests, claims, minerals and mineral rights, water and water rights, utility capacity, common property rights, and appurtenances ina any way belonging or appertaining to the Land and all of Transferor" S right, title, and interest in and to all adjoining streets, alleys, private roads, parking areas, curbs, curb cuts, sidewalks, landscaping, signage, sewers, and public ways (collectively,  described above to be referred to as the "Land";  (collectively, "Improvements");a and  "Appurtenant Rights").  Page 21    The Land, Improvements, and Appurtenant Rights described above are collectively PROVIDED THAT Transferor makes no representations or warranties regarding the condition of the Property, including, without limitation, thej physical and environmental condition of any real property, improvements, appurtenances or any other rights and title of the Transferor, if  referred tol herein as the "Property."  any, associated therewith.  AND PROVIDED THAT this conveyance and Quitclaim Deed is subject to the terms and conditions, covenants, obligations and responsibilities set forth in that certain Property Transfer "Underlying Agreement"). Any term not defined herein shall have the same meaning as set forth in the Underlying Agreement. The provisions following this paragraph are from the Underlying Agreement. To the extent of any conflict or discrepancy between this Quitclaim Deed and the Underlying Agreement with respect to such provisions or any other terms and conditions, covenants, obligations and responsibilities, the Underlying Agreement shall control.  Agreement entered by and between Transferor and Transferee, dated  2024 (the  AND FURTHER PROVIDED THE FOLLOWING: (A) Assumption ofObligations and Liabilities.  (i) Obligations of US-CO Consent Decree. As of and after the Closing Date, Transferee agrees to fully comply with, and be bound by, all provisions of Section XII of the US-CO Consent Decree applicable to Transferor and the related penalty provisions of Paragraph 11.b of US-CO Consent Decree, and requirements for subsequent conveyances by Transferee more fully set forth in paragraph (D) below. As of and after the Closing Date, Transferor shall be relieved of any and all ofi its obligations under Section XII and related penalty provisions of Paragraph 11.b of the US-CO Consent Decree, and shall take no further actions under or otherwise related to Section XII of the US-CO Consent Decree, including for any future response actions referenced in Paragraph 36 in Section XII ofthe US-CO consent Decree or institutional controls referenced in Paragraph 37 in Section XII of the US-CO Consent Decree, at or related to (ii) Other Obligations and Liabilities. As of and after the Closing Date, Transferee agrees to assume and be responsible for any and all obligations and liabilities, of any kind, character or nature, related to the Property and arising from any matters relating to the Transferee's ownership, use or non-use of, or actions or failures to act with respect to, the Property after the Closing Date, including, but not limited to, liabilities arising out of either pending or unasserted claims or litigation and any such liability or obligations under Environmental Laws (defined below) for or related to the Property. In connection with Transferee's assumptions herein, Transferee expressly acknowledges and understands that the Property may have been mined or operated or used as sites for tailings or other waste and refuse disposal and as  the Property.  Page 22    such, may be subject to statutes, laws, regulations, permits or orders imposing obligations in connection therewith (collectively, the "Environmental Laws"). (B) Release and Covenant Not to Sue by County. As ofClosing and as to the Property being acquired by Transferee, on behalf of itself and its successors and assigns, Transferee hereby releases any and all claims it may have, now or in the future, against Transferor and Transferor's Affiliated Parties (as defined below) (collectively, the "Released Parties") with respect to (i) any matters arising from or related to the Bonita Peak Mining District Site arising or accruing after the Closing Date, (ii) any matters relating to the Transferee's ownership, use or non- use of, or actions or failures to act with respect to, the Property after the Closing Date, including the environmental or physical condition of the Property, and (iii) all matters addressed in the US-CO Consent Decree. To the maximum extent permitted by law, Transferee fully and forever covenants not to sue or to institute or cause to be instituted any action in any federal, state or local agency or court against the Released Parties for indemnification or otherwise regarding any claims or matters released by Transferee in this Agreement and any obligations and liabilities assumed by Transferee under this Agreement. Transferor's Affiliated Parties" shall mean the Transferor, any assignee of Transferor, any Affiliate (as defined below) of Transferor, and all of their respective owners, directors, agents, officers, and employees. "Affiliate" means any entity, that directly or indirectly through one or more intermediaries, controls, is controlled by, or is under common control with the subject entity or entities. (C) Termination and Release of Existing Contractual Liabilities. Pursuant to that certain Land Exchange and Consolidation Agreement dated May 29, 2007 (the "2007 Agreement"), by and between Transferor and Transferee, the Transferee agreed to and thereafter quitclaimed to Transferor its interests in Eureka Parcels 1-6, located within the abandoned Eureka Townsite (collectively, the "Eureka Parcels") (which such parcels are to be re-conveyed to Transferee pursuant to the Underlying Agreement), subject to certain indemnification obligations ofTransferor in favor of Transferee for and related to thel Eureka Parcels, as set forth in Section 9 ofthe 2007 Agreement. By Closing the Underlying Agreement, Transferee hereby terminates and fully and forever releases Transferor from the indemnification obligations of Transferor under the 2007 Agreement with respect to the Eureka Parcels and agrees that such indemnification obligations of Transferor shall be null, void and of no  further force or effect after Closing.  (D) Future Conveyances Transferee agrees that in any subsequent conveyance of all or any portion of the Property, or any interest in the Property (including without limitation any grant of an easement burdening any of the Property or any grant ofa lease of all or any part of the Property), Transferee shall include the following provisions in the deed or other conveyance instrument, and include applicable dates and recording information for this Quitclaim Deed from Transferor to Transferee:  Page 23    Grantee hereby agrees to () accept the property subject to the covenants, obligations and responsibilities set forth in that certain Quitclaim Deed dated (ii) abide by and enforce the covenants and assume, undertake and perform the obligations and responsibilities as the owner of property in accordance with the terms and conditions of such Quitclaim Deed. Grantee hereby further agrees to be bound by the indemnity and release and covenant not to Grantee hereby further agrees that in any subsequent deed or other conveyance instrument, it shall require that the grantee in such deed or conveyance instrument either () execute a deed or conveyance instrument which contains the agreements set forth in the immediately preceding paragraph, or (ii) execute a separate acknowledgment attached to the deed or conveyance instrument which contains the agreements set forth in the  as of #  2024, and recorded on  2024, as Document  in the real property records of San Juan County, Colorado and  sue provisions set forth in the foregoing Quitclaim Deed.  immediately preceding paragraph.  TO HAVE AND TO HOLD under Transferee, and Transfèree's successors and assigns, EXEMPT FROM DOCUMENTARY FEE PURSUANT TOC.R.S. 39-13-1040)(a)  forever,  [Remainder of page intentionally left blank.]  Page 24    DATED this  day of  2024,  TRANSFEROR: Sunnyside Gold Corporation, al Delaware corporation  By: Name: Title:  STATE OF County of  :SS.  The foregoing instrument was acknowledged before me this  day of of Sunnyside  2024, by  as  Gold Corporation, a Delaware corporation.  [signature]  Notary Public for the State of (Printed Name) Residing at: My commission expires:  (SEAL)  (City)  (State) 20  Month/Day/Year)  Page 25    TRANSFEREE: San Juan County, Colorado, ap political subdivision oft the State ofColorado, by and through the Board of County Commissioners of the County of San Juan, Colorado  By: Name: Title:  Attested to by the Clerk to the Board:  STATEOF County of  SS.  The foregoing instrument was acknowledged before me this  day of for San Juan  2024, by  as  County, Colorado, a political subdivision of the State of Colorado, by and through the Board of  County Commissioners ofthe County of San Juan, Colorado.  [signature]  Notary Public for the State of (Printed Name) Residing at: My commission expires:  (SEAL)  (City)  (State) 20  Month/Day/Year)  Page 26    GUARANTEE  THIS GUARANTEE ("Guarantee") is made this day of subdivision oft the State ofColorado (the "County" or "Guaranteed Party").  2024, by  Kinross Gold U.S.A., Inc. ("KGUSA" or "Guarantor") in favor of San Juan County, a political  RECITALS  A. Sunnyside Gold Corporation ("SGC") intends to enter into a Property Transfer Agreement with the County whereby SGC would donate all its real property located in San Juan County to the County (the "Property Transfer Agreement"). B. Section 17 of the Property Transfer Agreement provides for KGUSA, as the indirect corporate parent of SGC, to provide a corporate guarantee on behalf of SGC, guaranteeing the obligations and liabilities of SGC under the Property Transfer Agreement (defined therein as the KGUSA Guarantee"). Such Section 17 provides that the KGUSA Guarantee shall be maintained for three years after the Closing Date (as defined in the Property Transfer Agreement), at which time KGUSA's obligations under the KGUSA Guarantee shall terminate, and such Section 17 also provides that the KGUSA Guarantee shall be subject to the dollar limitations in Sections 9(d) and 18 therein, and in no event shall KGUSA's maximum aggregate liability under Section 17 exceed such dollar limitations. C. Guarantor expects to derive benefits from the transaction which is the subject of the Property Transfer Agreement, and Guarantor finds it advantageous, desirable and in Guarantor's best interests to execute and deliver this Guarantee. NOW,THEREFORE, in consideration oft the Property Transfer Agreement and for other good and valuable consideration, Guarantor hereby covenants and agrees with the Guaranteed  Party as follows: 1.  Scope of Guarantee. Guarantor hereby absolutely and unconditionally  guarantees the prompt and complete pertormance ofall obligations and liabilities of SGC under the Property Transfer Agreement, pursuant to, and subject to, the provisions of Section 17 ofthe Property Transfer Agreement. This Guarantee shall be maintained for three years after the Closing Date (as defined in the Property Transfer Agreement), at which time Guarantor's obligations under this Guarantee shall terminate. This Guarantee shall be subject to the dollar limitations in Sections 9(d) and 18 of the Property Transfer Agreement, and in no event shall Guarantor's maximum aggregate liability under this Guarantee exceed such dollar limitations. The Guaranteed Party shall have no right to assert any claim or demand under this Guarantee unless and until the Guaranteed Party has exhausted all of its rights and remedies against SGC under the Property Transfer Agreement, and Guarantor's obligations under this Guarantee shall be limited to any deficiency after all of the Guaranteed Party's rights and remedies against SGC  under the Property Transfer Agreement have been exhausted.  2. Duration of Guarantee. This is a continuing guarantee and shall remain in full force and effect until the obligations and liabilities of SGC under the Property Transfer  Agreement have been fully and completely performed by SGC.  KGUSA 04/3020241 Draft Guarantee    3.  Assignment. The Guarantor may not assign this Guarantee without the written Cumulative Remedies. No failure to exercise and no delay in the exercise ofany  consent of the Guaranteed Party. The Guaranteed Party may not assign this Guarantee without  the written consent of Guarantor.  4.  right or remedy hereunder shall operate as a waiver thereof. All rights and remedies hereunder  are cumulative and may be exercised singly or concurrently.  5. Notices.  (a) All notices or deliveries required or permitted under this Guarantee shall be in writing and shall be hand-delivered, given by certified mail, return receipt requested or overnight courier, or sent by email to the party to be served at such email address set forth herein or supplied by each party to each other. A copy of such notice or other communication shall also be sent to  each party's attorneys.  (b) All notices sO given shall be considered effective: (i) if hand-delivered, when received; (ii) if delivered by courier, one (1) business day after timely deposit with the courier service, charges prepaid; (ii) if mailed, three (3) days after deposit, if postage prepaid, with the United States Postal Service; and (iv) if delivered by email, upon deposit of the message, as sent,  in the sender's email box.  (c) Either party may change the address to which future notices shall be sent by notice given in accordance with this section. Each party's attorney may send or receive notices at  the direction of and inj place of the respective party such attorney represents. the parties and their respective attorneys at the following addresses:  (d) Notices or deliveries required or permitted under this Agreement shall be sent to  Ifto Guarantor:  Kinross Gold U.S. A., Inc. Attn: General Counsel 5075 S Syracuse Street, Suite 800 Denver, Colorado 80237 LegiNoticesgkmpis.com Crowley Fleck PLLP Attn: Neil G. Westesen 9001 N. Last Chance Gulch Suite 200 Helena, MT 59601 nwestesen@crowleytleck.com San Juan County Attn: Dennis Golbricht 1557 Greene Street Silverton, Colorado 81433 emms@animaslaw.com  With a copy to:  Ifto Guaranteed Party:  KGUSA 04/302024 Draft Guarantee  2    With a copy to:  Ireland, Stapleton, Pryor & Pascoe, P.C, 1660 Lincoln Street, Suite 3000 Denver, CO 80264 ralmon@irelandstapleton.com  6.  Governing Law. This Guarantee shall be governed by and construed in 7. Severability. The unenforceability or invalidity of any provisions hereof shall not render any other provision or provisions herein contained unenforceable or invalid.  accordance with the laws oft the State ofColorado..  8. 9.  Time. Time shall be of the essence ofthis Guarantee.  Entire Agreement This Guarantee, in conjunction with the Property Transfer  Agreement, sets forth the entire agreement between the Guarantor and the Guaranteed Party and supersedes any prior written or oral statements or agreements with respect to the matters covered hereby. This Agreement shall be amended only by a writing executed by the Guarantor and the  Guaranteed Party.  10. Binding Effect. This Guarantee shall be binding upon Guarantor's successors, IN WITNESS WHEREOF, the parties have executed this Guarantee effective as oft the  and shall inure to the benefit of Guaranteed Party and its successors.  date first above written.  Kinross Gold U.S.A., Inc. al Nevada  corporation By: Name: Title:  "Guarantor"  San Juan County, a political subdivision of the State of Colorado, by and through the Board of County Commissioners: of the County of San  Juan, Colorado By: Name: 3  KGUSA 04/302024 Draft Guarantee    Title:  "Guaranteed Party"  KGUSA 04/302024 Draft Guarantee  4    GUARANTEE  THIS GUARANTEE ("Guarantee") is made this day of subdivision of the State ofColorado (the "County" or' "Guaranteed Party").  2024, by  Kinross Gold U.S.A., Inc. ("KGUSA" or "Guarantor") in favor of San Juan County, a political  RECITALS  A. Sunnyside Gold Corporation ("SGC") intends to enter into a Property Transfer Agreement with the County whereby SGC would donate all its real property located in San Juan County to the County (the "Property Transfer Agreement"). B. Section 17 of the Property Transfer Agreement provides for KGUSA, as the indirect corporate parent of SGC, to provide a corporate guarantee on behalf of SGC, guaranteeing the obligations and liabilities of SGC under the Property Transfer Agreement (defined therein as the "KGUSA Guarantee"). Such Section 17 provides that the KGUSA Guarantee shall be maintained for three years after the Closing Date (as defined in the Property Transfer Agreement), at which time KGUSA's obligations under the KGUSA Guarantee shall terminate, and such Section 17 also provides that the KGUSA Guarantee shall be subject to the dollar limitations in Sections 9(d) and 18 therein, and in no event shall KGUSA's maximum aggregate liability under Section 17 exceed such dollar limitations. Guarantor expects to derive benefits from the transaction which is the subject of the Property Transfer Agreement, and Guarantor finds it advantageous, desirable and in Guarantor's best interests to execute and deliver this Guarantee. NOW, THEREFORE, in consideration of the Property Transfer Agreement and for other good and valuable consideration, Guarantor hereby covenants and agrees with the Guaranteed  C.  Party as follows: 1.  Scope of Guarantee. Guarantor hereby absolutely and unconditionally  guarantees the prompt and complete performance of all obligations and liabilities of SGC under the Property Transfer Agreement, pursuant to, and subject to, the provisions of Section 17 ofthe Property Transfer Agreement. This Guarantee shall be maintained for three years after the Closing Date (as defined in the Property Transfer Agreement), at which time Guarantor's obligations under this Guarantee shall terminate. This Guarantee shall be subject to the dollar limitations in Sections 9(d) and 18 of the Property Transfer Agreement, and in no event shall Guarantor's maximum aggregate liability under this Guarantee exceed such dollar limitations. The Guaranteed Party shall have no right to assert any claim or demand under this Guarantee unless and until the Guaranteed Party has exhausted all of its rights and remedies against SGC under the Property Transfer Agreement, and Guarantor's obligations under this Guarantee shall be limited to any deficiency after all of the Guaranteed Party's rights and remedies against SGC  under the Property Transfer Agreement have been exhausted.  2.  Duration of Guarantee. This is a continuing guarantee and shall remain in full  force and effect until the obligations and liabilities of SGC under the Property Transfer  Agreement have been fully and completely performed by SGC.  KGUSA 04/302024 Draft Guarantee    3. Assignment The Guarantor may not assign this Guarantee without the written consent of the Guaranteed Party. The Guaranteed Party may not assign this Guarantee without 4. Cumulative Remedies. No failure to exercise and no delay in the exercise ofany right or remedy hereunder shall operate as a waiver thereof. All rights and remedies hereunder  the written consent of Guarantor.  are cumulative and may be exercised singly or concurrently.  5. Notices.  (a) All notices or deliveries required or permitted under this Guarantee shall be in writing and shall be hand-delivered, given by certified mail, return receipt requested or overnight courier, or sent by email to the party to be served at such email address set forth herein or supplied by each party to each other. A copy of such notice or other communication shall also be sent to  each party's attoreys.  (b) All notices SO given shall be considered effective: (i) if hand-delivered, when received; (i) if delivered by courier, one (1) business day after timely deposit with the courier service, charges prepaid; (ii) if mailed, three (3) days after deposit, if postage prepaid, with the United States Postal Service; and (iv) ifd delivered by email, upon deposit of the message, as sent,  in the sender's email box.  (c) Either party may change the address to which future notices shall be sent by notice given in accordance with this section. Each party's attorney may send or receive notices at  the direction of and in place oft the respective party such attorney represents. the parties and their respective attorneys at the following addresses:  (d) Notices or deliveries required or permitted under this Agreement shall be sent to  Ifto Guarantor:  Kinross Gold U.S. A., Inc. Attn: General Counsel 5075 S Syracuse Street, Suite 800 Denver, Colorado 80237 gaNoicsekmoscon Crowley Fleck PLLP Attn: Neil G. Westesen 9001 N. Last Chance Gulch Suite 200 Helena, MT 59601 setsem@swlgyleakceon San Juan County Attn: Dennis Golbricht 1557 Greene Street Silverton, Colorado 81433 demns@animaslaw.com  With a copy to:  Ifto Guaranteed Party:  KGUSA 04/302024 Draft Guarantee  2    With a copy to:  Ireland, Stapleton, Pryor & Pascoe, P.C. 1660 Lincoln Street, Suite 3000 Denver, CO 80264 monarcimasepeon.on  6. Governing Law. This Guarantee shall be governed by and construed in 7. Severability. The unenforceability or invalidity of any provisions hereof shall not render any other provision or provisions herein contained unenforceable or invalid.  accordance with the laws oft the State ofColorado,  8. Time. Time shall be of the essence of this Guarantee.  9.  Entire Agreement. This Guarantee, in conjunction with the Property Transfer  Agreement, sets forth the entire agreement between the Guarantor and the Guaranteed Party and supersedes any prior written or oral statements or agreements with respect to the matters covered hereby. This Agreement shall be amended only by a writing executed by the Guarantor and the  Guaranteed Party.  10. Binding Effect. This Guarantee shall be binding upon Guarantor's successors, IN WITNESS WHEREOF, the parties have executed this Guarantee effective as oft the  and shall inure to the benefit of Guaranteed Party and its successors.  date first above written.  Kinross Gold U.S.A., Inc. a Nevada  corporation By: Name: Title:  "Guarantor"  San Juan County, a political subdivision of the State of Colorado, by and through the Board of County Commissioners of the County of San  Juan, Colorado By: Name: 3  KGUSA 04/302024 Draft Guarantee    Title:  "Guaranteed Party"  KGUSA 04/302024 Draft Guarantee  4    GUARANTEE  THIS GUARANTEE ("Guarantee") is made this day of subdivision oft the State of Colorado (the "County" or' "Guaranteed Party").  2024, by  Kinross Gold U.S.A., Inc. ("KGUSA" or "Guarantor") in favor of San Juan County, a political  RECITALS  A. Sunnyside Gold Corporation ("SGC") intends to enter into a Property Transfer Agreement with the County whereby SGC would donate all its real property located in San Juan County to the County (the "Property Transfer Agreement"). B. Section 17 of the Property Transfer Agreement provides for KGUSA, as the indirect corporate parent of SGC, to provide a corporate guarantee on behalf of SGC, guaranteeing the obligations and liabilities of SGC under the Property Transfer Agreement (defined therein as the "KGUSA Guarantee"). Such Section 17 provides that the KGUSA Guarantee shall be maintained for three years after the Closing Date (as defined in the Property Transfer Agreement), at which time KGUSA's obligations under the KGUSA Guarantee shall terminate, and such Section 17 also provides that the KGUSA Guarantee shall be subject to the dollar limitations in Sections 9(d) and 18 therein, and in no event shall KGUSA's maximum aggregate liability under Section 17 exceed such dollar limitations. C. Guarantor expects to derive benefits from the transaction which is the subject of the Property Transfer Agreement, and Guarantor finds it advantageous, desirable and in Guarantor's best interests to execute and deliver this Guarantee. NOW, THEREFORE, in consideration oft the Property Transfer Agreement and for other good and valuable consideration, Guarantor hereby covenants and agrees with the Guaranteed  Party as follows:  1. Scope of Guarantee. Guarantor hereby absolutely and unconditionally guarantees the prompt and complete performance of all obligations and liabilities of SGC under the Property Transfer Agreement, pursuant to, and subject to, the provisions of Section 17 ofthe Property Transfer Agreement. This Guarantee shall be maintained for three years after the Closing Date (as defined in the Property Transfer Agreement), at which time Guarantor's obligations under this Guarantee shall terminate. This Guarantee shall be subject to the dollar limitations in Sections 9(d) and 18 of the Property Transfer Agreement, and in no event shall Guarantor's maximum aggregate liability under this Guarantee exceed such dollar limitations. The Guaranteed Party shall have no right to assert any claim or demand under this Guarantee unless and until the Guaranteed Party has exhausted all of its rights and remedies against SGC under the Property Transfer Agreement, and Guarantor's obligations under this Guarantee shall be limited to any deficiency after all oft the Guaranteed Party's rights and remedies against SGC  under the Property Transfer Agreement have been exhausted.  2.  Duration of Guarantee. This is a continuing guarantee and shall remain in full  force and effect until the obligations and liabilities of SGC under the Property Transfer  Agreement have been fully and completely performed by SGC.  KGUSA 04/3020241 Draft Guarantee    3.  Assignment The Guarantor may not assign this Guarantee without the written  consent of the Guaranteed Party. The Guaranteed Party may not assign this Guarantee without  the written consent of Guarantor.  4.  Cumulative Remedies. No failure to exercise and no delay int the exercise ofa any  right or remedy hereunder shall operate as a waiver thereof. All rights and remedies hereunder  are cumulative and may be exercised singly or concurrently.  5.  Notices.  (a) All notices or deliveries required or permitted under this Guarantee shall be in writing and shall be hand-delivered, given by certified mail, return receipt requested or overnight courier, or sent by email to the party to be served at such email address set forth herein or supplied by each party to each other. A copy of such notice or other communication shall also be sent to  each party's attorneys.  (b) All notices sO given shall be considered effective: (i) if hand-delivered, when received; (ii) if delivered by courier, one (1) business day after timely deposit with the courier service, charges prepaid; (iii) if mailed, three (3) days after deposit, if postage prepaid, with the United States Postal Service; and (iv) if delivered by email, upon deposit of the message, as sent,  in the sender's email box.  (c) Either party may change the address to which future notices shall be sent by notice given in accordance with this section. Each party's attorney may send or receive notices at  the direction of and in place oft the respective party such attorney represents. the parties and their respective attorneys at the following addresses:  (d) Notices or deliveries required or permitted under this Agreement shall be sent to  Ifto Guarantor:  Kinross Gold U.S. A., Inc. Attn: General Counsel 5075 S Syracuse Street, Suite 800 Denver, Colorado 80237 gNotca@kmoscon Crowley Fleck PLLP Attn: Neil G. Westesen 9001 N. Last Chance Gulch Suite 200 Helena, MT 59601 nwestesen@crowleytleck.com San Juan County Attn: Dennis Golbricht 1557 Greene Street Silverton, Colorado 81433 demms@animasiaw.com  With a copy to:  Ifto Guaranteed Party:  KGUSA 04/302024 Draft Guarantee  2    With a copy to:  Ireland, Stapleton, Pryor & Pascoe, P.C. 1660 Lincoln Street, Suite 3000 Denver, CO 80264 imamdireimaup-son.on  6.  Governing Law. This Guarantee shall be governed by and construed in 7. Severability. The unenforceability or invalidity of any provisions hereof shall not render any other provision or provisions herein contained unenforceable or invalid.  accordance with the laws of the State of Colorado..  8. Time. Time shall be oft the essence oft this Guarantee.  9.  Entire Agreement. This Guarantee, in conjunction with the Property Transfer  Agreement, sets forth the entire agreement between the Guarantor and the Guaranteed Party and supersedes any prior written or oral statements or agreements with respect to the matters covered hereby. This Agreement shall be amended only by a writing executed by the Guarantor and the  Guaranteed Party.  10. Binding Effect. This Guarantee shall be binding upon Guarantor's successors, IN WITNESS WHEREOF, the parties have executed this Guarantee effective as oft the  and shall inure to the benefit of Guaranteed Party and its successors.  date first above written.  Kinross Gold U.S.A., Inc. al Nevada  corporation By: Name: Title:  "Guarantor"  San Juan County, aj political subdivision of the State of Colorado, by and through the Board of County Commissioners of the County of San  Juan, Colorado By: Name: 3  KGUSA 04/302024 Draft Guarantee    Title:  "Guaranteed Party"  KGUSA 04/302024 Draft Guarantee  4    GUARANTEE  THIS GUARANTEE ("Guarantee") is made this day of subdivision oft the State ofColorado (the "County" or "Guaranteed Party").  2024, by  Kinross Gold U.S.A., Inc. ("KGUSA" or "Guarantor") in favor of San Juan County, a political  RECITALS  A. Sunnyside Gold Corporation ("SGC") intends to enter into a Property Transfer Agreement with the County whereby SGC would donate all its real property located in San Juan County to the County (the Property Transfer Agreement"). B. Section 17 of the Property Transfer Agreement provides for KGUSA, as the indirect corporate parent of SGC, to provide a corporate guarantee on behalf of SGC, guaranteeing the obligations and liabilities of SGC under the Property Transfer Agreement (defined therein as the "KGUSA Guarantee"). Such Section 17 provides that the KGUSA Guarantee shall be maintained for three years after the Closing Date (as defined in the Property Transfer Agreement), at which time KGUSA's obligations under the KGUSA Guarantee shall terminate, and such Section 17 also provides that the KGUSA Guarantee shall be subject to the dollar limitations in Sections 9(d) and 18 therein, and in no event shall KGUSA's maximum aggregate liability under Section 17 exceed such dollar limitations. Guarantor expects to derive benefits from the transaction which is the subject of the Property Transfer Agreement, and Guarantor finds it advantageous, desirable and in Guarantor's best interests to execute and deliver this Guarantee. NOW, THEREFORE, in consideration oft the Property Transfer Agreement and for other good and valuable consideration, Guarantor hereby covenants and agrees with the Guaranteed  Party as follows:  1. Scope of Guarantee. Guarantor hereby absolutely and unconditionally guarantees the prompt and complete performance ofa all obligations and liabilities of SGC under the Property Transfer Agreement, pursuant to, and subject to, the provisions of Section 17 ofthe Property Transfer Agreement. This Guarantee shall be maintained for three years after the Closing Date (as defined in the Property Transfer Agreement), at which time Guarantor's obligations under this Guarantee shall terminate. This Guarantee shall be subject to the dollar limitations in Sections 9(d) and 18 of the Property Transfer Agreement, and in no event shall Guarantor's maximum aggregate liability under this Guarantee exceed such dollar limitations. The Guaranteed Party shall have no right to assert any claim or demand under this Guarantee unless and until the Guaranteed Party has exhausted all of its rights and remedies against SGC under the Property Transfer Agreement, and Guarantor's obligations under this Guarantee shall be limited to any deficiency after all of the Guaranteed Party's rights and remedies against SGC  under the Property Transfer Agreement have been exhausted.  2.  Duration of Guarantee. This is a continuing guarantee and shall remain in full  force and effect until the obligations and liabilities of SGC under the Property Transfer  Agreement have been fully and completely performed by SGC.  KGUSA 04/302024 Draft Guarantee    3.  Assignment. The Guarantor may not assign this Guarantee without the written  consent of the Guaranteed Party. The Guaranteed Party may not assign this Guarantee without  the written consent of Guarantor.  4.  Cumulative Remedies. No failure to exercise and no delay in the exercise ofany  right or remedy hereunder shall operate as a waiver thereof. All rights and remedies hereunder  are cumulative and may be exercised singly or concurrently.  5.  Notices.  (a) All notices or deliveries required or permitted under this Guarantee shall be in writing and shall be hand-delivered, given by certified mail, return receipt requested or overnight courier, or sent by email to the party to be served at such email address set forth herein or supplied by each party to each other. A copy of such notice or other communication shall also be sent to  each party's attorneys.  (b) All notices sO given shall be considered effective: (i) if hand-delivered, when received; (ii) if delivered by courier, one (1) business day after timely deposit with the courier service, charges prepaid; (in) if mailed, three (3) days after deposit, if postage prepaid, with the United States Postal Service; and (iv) if delivered by email, upon deposit of the message, as sent,  in the sender's email box.  (c) Either party may change the address to which future notices shall be sent by notice given in accordance with this section. Each party's attorney may send or receive notices at (d) Notices or deliveries required or permitted under this Agreement shall be sent to  the direction of and inj place of the respective party such attorney represents. the parties and their respective attorneys at the following addresses:  Ifto Guarantor:  Kinross Gold U.S. A., Inc. Attn: General Counsel 5075 S Syracuse Street, Suite 800 Denver, Colorado 80237 egaNoicesekmoscon Crowley Fleck PLLP Attn: Neil G. Westesen 9001 N. Last Chance Gulch Suite 200 Helena, MT 59601 tsmeowlyleakcon San Juan County Attn: Dennis Golbricht 1557 Greene Street Silverton, Colorado 81433 emnis@animaslaw.com  With a copy to:  Ifto Guaranteed Party:  KGUSA 04/302024 Draft Guarantee  2    With a copy to:  Ireland, Stapleton, Pryor & Pascoe, P.C. 1660 Lincoln Street, Suite 3000 Denver, CO 80264 aimamdireimup-on.on  6. Governing Law. This Guarantee shall be governed by and construed in 7. Severability. The unenforceability or invalidity of any provisions hereof shall not render any other provision or provisions herein contained unenforceable or invalid.  accordance with the laws of the State ofColorado.  8. Time. Time shall be oft the essence of this Guarantee.  9.  Entire Agreement. This Guarantee, in conjunction with the Property Transfer  Agreement, sets forth the entire agreement between the Guarantor and the Guaranteed Party and supersedes any prior written or oral statements or agreements with respect to the matters covered hereby. This Agreement shall be amended only by a writing executed by the Guarantor and the  Guaranteed Party.  10. Binding Effect. This Guarantee shall be binding upon Guarantor's successors, IN WITNESS WHEREOF, the parties have executed this Guarantee effective as oft the  and shall inure to the benefit of Guaranteed Party and its successors.  date first above written.  Kinross Gold U.S.A., Inc. a Nevada  corporation By: Name: Title:  "Guarantor"  San Juan County, a political subdivision of the State of Colorado, by and through the Board of County Commissioners of the County of San  Juan, Colorado By: Name: 3  KGUSA 04/302024 Draft Guarantee    Title:  "Guaranteed Party"  KGUSA 04/302024: Draft Guarantee  4    SAN JUAN COUNTY RESOLUTION 2024-  A RESOLUTION APPROVING THE ACCEPTANCE OF DONATED REAL PROPERTY FROM SUNNYSIDE GOLD CORPORATION WITH CONDITIONS AND OBLIGATIONS AS SET FORTH IN THE PROPERTY TRANSFER AGREEMENT AND CONVEYANCE DEED, AND AUTHORIZING EXECUTION ALL NECESSARY DOCUMENTS WHEREAS, San Juan County (the "County") has conditionally agreed to accept a donation of certain real property from Sunnyside Gold Corporation ("Sunnyside");: and WHEREAS, pursuant to the provisions of CRS 30-11-101()), the County has the power to purchase and hold real property for the use oft the County; and WHEREAS, the donated real property ("the "Property") is comprised of approximately 124 mining claims located on 31 parcels over approximately 1,202 acres in San Juan County, WHEREAS, due to significant topographical limitations and the fact that San Juan County is comprised of almost ninety (90) percent federal land, there is a severe shortage of useable real WHEREAS, the acquisition of the Property for current and foreseeable future needs, directly benefits the health, safety and welfare of all persons living within or visiting the County, and is WHEREAS, future use of the Property could include emergency services, much needed parking/staging areas, County facilities, conservatiomprseration of sensitive areas, protection WHEREAS, thc donation offered does not allow for selecting individual properties, but instead WHEREAS, the Property is located entirely in the United States Environmental Protection Agency (EPA) Bonita Peak Mining District Superfund Site ("BPMD") due to mining impacts; WHEREAS, the Property has varying amounts of mining impacts; many of the mining claims were simply shallow discovery diggings to establish a claim and were not impacted by mining activities, while other of the properties that had been mined for ore have been investigated and remediated by relocation and stabilization of the mine tailings, and engineered water collection and settlement ponds were constructed in areas where mine water was discharging, all to the WHEREAS, certain portion of the of the Property is subject to ongoing and possibly long-term  Colorado; and  property available for local public facilities; and  in the best interest oft the inhabitants oft the County; and  ofmine remediation features, and recreation; and requires the acceptance of all included properties; and  and  satisfaction ofthe EPA; and  active and pending remediation for management of groundwater; and    WHEREAS, the Comprehensive Environmental Response, Compensation, and Liability Act ("CERCLA") imposes strict liability for certain types of environmental contamination on real property even ift the property owner was not responsible for causing the contamination; and WHEREAS, in considering whether to accept the donated Property, the County retained a law firm with expertise in the field of determining possible liabilities, and obtaining certain liability protection under CERCLA, including a Bona Fide Prospective Purchaser ("BFPP") defense; and WHEREAS, to be eligible for BFPP protections, the County must meet certain criteria, including full cooperation with state and federal agencies as to efforts to address contamination, the implementation of reasonable steps to avoid actions that threaten to cause new or increased exposure to contamination at the Property, and thorough investigation and due diligence prior to WHEREAS, the County will continue to work closely with the EPA and CDPHE, who have confirmed that they will continue to conduct CERCLA response actions at the subject Property WHEREAS, San Juan County Ordinance Number 2020-01 was adopted on December 15, 2020 for the regulation of land use within the BPMD. This ordinance provides San Juan County with jurisdiction over Mine Waste Source Areas to control and regulate land use within unincorporated San Juan County where residual mine waste and remediation components exist, WHEREAS, the County has obtained an extensive American Society for Testing and Materials Phase 1 Environmental Site Assessment Report (the "ESA") on the Property, with updates twice since 2022, satisfying the investigation and due diligence requirement for BFPP protections; and WHEREAS, based upon expert opinion received, the County has the reasonable belief that it will WHEREAS, the County has obtained confirmation from the EPA and CDPHE in the form of a "Comfort Letter" setting forth actions and non-actions of the County required in obtaining and retaining the BFPP liability protections, while utilizing the Property for possible specific uses; WHEREAS, the County understands that even with the BFPP liability protections, there are certain risks associated with accepting donation of the Property, including, but not limited to extensive maintenance and preservation of the Property and specific remediation features, as WHEREAS, the County further believes that the strong working relationship it enjoys with the EPA and the CDPHE will continue into the future, providing for significant support and assistance to the County in the event of future maintenance and/or remediation needs related to WHEREAS, the County has aggressively negotiated the attached Property Transfer Agreement with Sunnyside, which provides some limited further protections to the County; and  acquisition ofthel Property; and  within the BPMD; and  including specifically the Superfund site; and  be entitled to the BFPP CERCLA liability protections; and  and  well as possible non-CERCLA related claims; and  the Property; and  2    WHERAS, the County has carefully weighed the benefits of acquiring the Property, against the WHEREAS, given the extremely unique opportunity to secure the significant amount of real property for the benefit of current and future generations of residents and visitors of San Juan THE BOARD OF COUNTY COMMISSIONERS OF SAN JUAN COUNTY, STATE OF 1. The Property Transfer Agreement attached hereto, which includes the legal descriptions oft the Property, is hereby approved and accepted, with the Board Chair Austin Lashley 2. Pursuant to the Property Transfer Agreement, the County shall have up to an additional thirty (30) days in which to complete any further due diligence, with closing to occur (presuming acceptable diligence results) as to be scheduled. The Board Chair Austin Lashley shall be authorized to execute all other documents necessary to close the transaction, including the proposed Quitclaim Deed, which is attached to the Transfer 3. Upon closing oft the transaction, the County shall establish aj property inspection program, to determine the need for any maintenance or remediation action. Said inspections shall be conducted with representatives oft the EPA and CDPHE as possible. 4. The County shall follow all recommendations and requirements as set forth in the EPA and CDPHE "Comfort Letter" dated March 31,2023, and any updates thereto.  potential liability and costs ofownership; and  County, and after taking reasonable steps to mitigate potential liability, COLORADO (THE "BOARD") HEREBY RESOLVES:  authorized to execute said document.  Agreement.  APPROVED and ADOPTED the 24th!h day of. July 2024.  Attest:  Pete Maisel  Scott Fetchenhier  Ladonna L. Jaramillo Clerk and Recorder  Austin Lashley, Chairperson  3        7/23/24, 10:38AM  San. Juan County Mail- Sunnyside Mining Claims Phase IESAF Report  Sunnyside Mining Claims PhaselESA Report  Jenkins, Joy Jenkns.oygepagov,  Mon, Jul22,2024a at 3:16PM  To: Anthony Edwards canthony@sholeredwards.com>, admin@sanjuancolorado.us omésnarconour Cc: "Lindsey, William" uindseyWilam@epa.gov2,Santor, Kate" Santordkale@epagow, maruopnesalecous  markrudo.ph@state.co.us,Jason.King@coag.gy'<Jason.king@coag.gov>  Anthony and Willy- -  This email is to acknowledge that the Phase B Environmental Site Assessment has been completed within the 6 months prior to the planned acquisition of the Sunnyside properties by San Juan County. This email also affirms that EPA's Reasonable Steps/Comfort letter to the County dated March 2023 is still valid. Ihave attached the letter here. You will note thet first page oft the letter has our EPA: site records center recording code on it demonstrating that this letteri is in our  official site file record.  Please let us knowi ify you have any questions and thank you for continuing to discuss potential future plans for the land  with EPAa and CDPHE. Thank you, Joy Jenkins  Joy Jenkins, Ph.D., P.E. Remedial Project Manager U.S. EPAI Region 8 Mobile: 720-951-0793 E-mail: jenkinsjoy@epa.gov  Superfund Remedial Branch (8SEM-RB-SB)  Mbpapmasgooe.comimainuons-tSaadhswlaschascummammcmAiNSISMEAaTwPasaincimsetieBRE180S3ISABAEBTOTE 1/1        100013148    UNITED STATES ENVIRONMENTAL PROTECTION. AGENCY  REGION8 1595 Wynkoop Street Denver, CO 80202-1129 Phone 800-227-8917 www.epa.gov/regions Date: March 31, 2023  Board of County Commissioners San Juan County, Colorado 1557 Greene Street Silverton, Colorado 81433  Re: Properties Located in San Juan County, Colorado Described in Appendix A Bonita Peak Mining District Superfund Site, San Juan County, Colorado  Dear San Juan Board of County Commissioners:  Thank you for contacting the U.S. Environmental Protection Agency (EPA or the Agency) on November 17,2022, regarding San Juan County's (SJC) plans concerning the above-referenced properties (Properties), located within or near the Bonita Peak Mining District Superfund Site (BPMD Site). You requested that the EPA provide you with a Superfund comfort/status letter. In a follow-up email, on December 16, 2022, you described SJC's interest in acquiring the Properties for various purposes. SJC intends to use those Properties above tree line for recreational and park activities; those Properties within the Mayflower impoundment areas, where appropriate, for temporary parking, storage of vehicles, equipment and gravel; and those Properties at Eureka, where appropriate, for residential and The purpose oft this comfort/status letter is to provide you with information that may be relevant to the potential Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) liability conçerns you have identified at the Properties and summarize the relevant information available to thel EPA about the Properties as of the date of this letter. We hope this information will enable you to make informed decisions as you move forward with your plans regarding the Properties. Under CERCLA (commonly referred to as Superfund), the Agency's mission is to protect human health and the environment from risks posed by exposure to contaminated or potentially contaminated land, water, and other media. A Superfund cleanup can help return properties to productive reuse. We are providing this letter consistent with the Agency's 2019 Comfort/Status letter policy.?  camping uses.  Property Status  Interested parties can find information on sites that are, or potentially are, contaminated and may warrant action under Superfund, including site-specific documents and fact sheets, ini the Superfund  '42U.S.C. SS 9601, ets sey-  See. 2019 Policyon the Issuance of Superfind Comfort's Status Letfers (Aug. 21,2019), available on the Agency'sweb:iteat  bs XXAMXAEA CAaumteaniaulaww    Enterprise Management System (SEMS). Additional information on the BPMD Site may be found at: This Site ist recorded in SEMS and is on the National Priorities List (NPL). For the reasons stated below,  https: cumulis.epuLyor supercpud cursites sitinta,m.-1NDV7. we are addressing the Site under Superfund remedial authority.  History and Status of the Site  The BPMD Site was listed on the NPL on September 9, 2016. At the time ofl listing, the EPA identified 48 mining related source areas. While the EPA has not selected aj permanent remedy for the Site, the EPA has taken, ori is taking, various response actions at the Site. In addition, certain potentially responsible parties are performing removal actions pursuant to. EPA oversight. The remedy decisions to date at the BPMD Site are as follows:  1) Removal action to treat mine drainage from the Gold King Mine. Relevant documents can be found at  the following links  Action Memorandum for Non-Time-Cnitical Removal Action: https: semspub.epa.gov work 08 1834188.pdf Ceiling increase for the Non-Time-Critical Removal Action: https: semspub ep.gorwork 08 1929681.pdf  2) Removal actions taken by PRPs at the London Mine and the Ben Franklin Mine:  2019 Ben Franklin Mine Administrative Order on Consent: https: semspubepagosurs, 08 10000672+.pdr 2021 London Mine Administrative Order on Consent: https: semspub.epagor sorkos 197x258.pdf  3)1 Two Interim Records ofDecision:  2019 Interim Record of Decision addressing 26 source area: https: semspubpugosork 08 100006-05.pdr 2021 Interim Record of Decision for the Sitewide Repository: hmps semspubigpgor work OX 00D10443pdr  Ins support of the 2019 Interim Record of Decision' s selected remedy, San Juan County, Colorado, passed a local ordinance implementing institutional controls at Remediated Mine Waste Source Areas restricting soil disturbing activities to protect the remedy and prevent unacceptable exposure to residual  contamination. A copy of the Ordinance can be found here:  heps mnsamns.ulorgusiss sanancoints fiesunim.ns 2020-  Lacamalmmalcinals  SEMS isa available at: PTHaDISN SWPRPNIRINlkshAls.TEL  2    Reuse of the Property  Based on the information you provided, the EPA understands that you intend to use the Properties in various ways. SJC intends to use those Properties above tree line for recreational and park activities. SJC intends to use some portion oft those Properties in the Mayflower impoundment areas for temporary parking, storage of vehicles, equipment and gravel. SJC intends to use aj portion of those Properties in Eureka for residential and camping uses. To ensure the remedy remains protective ofhuman health and the environment, any development must be compatible with the EPA and the Colorado Department of Public Health and Environment (CDPHE) cleanup actions and institutional controls designed toj protect the remedy and prevent unacceptable exposure to residual contamination. As oft the date oft this letter, we have not identified any obvious incompatibility between your proposed use ofthe Properties above tree line as you have described it to us. Given that final remedies have not been selected at thel Mayflower and Eureka areas and that remedial investigation work is ongoing, please continue to discuss your plans with us as they develop to ensure compatibility with future Superfund response actions. CERCLA's Bona Fide Prospective Purchaser Liability Protection  The EPA is providing you with information regarding the bona fide prospective purchaser (BFPP) provision of CERCLA. Congress amended CERCLA in 2002 to exempt certain parties who buy contaminated or potentially contaminated properties from CERCLA liability ifthey qualify as BFPPS, The BFPP provision provides that a person who meets the criteria of CERCLA 88 101(40) and 107(r)(1), and who purchases the property after January 11, 2002, will not be liable as an owner or Al key advantage oft the BFPP provision is that it is self-implementing: therefore, the Agency is not involved in determining whether a party qualifies for BFPP status. A party, on its own, can achieve and maintain status as a BFPP, which provides statutory protection from CERCLA liability, without entering into an agreement with the EPA, SO long as that party meets the threshold criteria and continuing Based upon your representation ofyour situation, the BFPP provision may apply. Note that a court, rather than the EPA, ultimately determines whether a landownerhasi met the criteria for BFPP status. Thus, the EPA recommends that you consult with your legal counsel to assess whether you satisfy each  operator under CERCLA.  obligations identified in the statute.  ofthes statutory requirements necessary to achieve and maintain BFPP status.  Reasonable Steps  Among other criteria outlined in CERCLA, a BFPP must take "reasonable steps" to stop continuing releases, prevent threatened future releases, and prevent or limit human, environmental, or natural resources exposure to any previously-released hazardous substances as required by CERCLA $101(40)B)(v). This requirement is explored further in the Common Elements Guidance. By making the BFPP Exemption subject to the obligation to take reasonable steps, the EPA believes Congress intended to protect certain landowners from CERCLA liability while at the same time 'See EPA's Enforcement Discretion Guidance Regarding Statutory Criteri, for Those Who. May Qualify as CERCLA Bonu Fide Prospective. Purchasers, Contiguous Propert: Oners, or Innocent Landowners ("Common Elements Guidance") (Office of Enforcement and Compliance Assurance, July 2,2019)available: on the Agency's website at  hms A MEENpde  Sld.  3    recognizing that these landowners should act reasonably, in conjunction with other authorized parties, in protecting human health and the environment. As noted above, the Agency has taken a number of response actions at the Site and has identified several environmental concerns. Based on the information we have evaluated, we believe that the following may be reasonable steps related to the hazardous 1. Provide access to the Properties at all reasonable times for purposes ofs site investigatory activities, performing the cleanup, groundwater and surface water monitoring, conducting five- year reviews, conducting operations and maintenance (0&M) activities, and monitoring compliance with environmental institutional controls by the EPA, CDPHE and their respective 2. Report any damage or disturbance to any remedial features to the EPA and CDPHE; 3. Discuss any development plans at any of the Properties before implementation with EPA and CDPHE project managers to ensure consistency with EPA response actions; 4. Refrain from impeding any response action or natural resource remediation or restoration actions ont the Properties, including, but not limited to, failing to abide by environmental institutional 5. Refrain from using the Properties in a manner that likely would interfere with or adversely affect the implementation, integrity, or protectiveness oft the response actions being performed by the 6. Comply with any future environmental institutional controls which are adopted as part oft the 8. Call the EPA's regional Emergency Response Center hotline at 303-312-6312 or 1-800-227- 9. Execute an environmental covenant or restrictive notice at the request oft the EPA or CDPHE. Any reasonable steps suggested by the EPA are based on the nature and extent of contamination currently known to the Agency and are provided as a guide to help you as you seek to reuse the Properties. Because ai final determination about which steps are reasonable would be made by a court rather than the EPA, and because additional reasonable steps may later be necessary based on site conditions, this list ofreasonable steps is not exhaustive. You should continue to identify reasonable steps based on your observation and judgment and take appropriate action to implement any reasonable  substance contamination found at the Site:  authorized representatives and contractors;  controls;  EPA or the CDPHE pursuant to CERCLA remedy decision documents; remedy selected by the Agency ini records of decision; 7. Comply with San Juan County Ordinance 2020-01;  8917 to report the discovery or release ofany hazardous substances; and  steps whether EPA regional staff has identified any such steps.?  State Actions  This letter was written in consultation with CDPHE. For additional information about potential state actions and liability issues, please contact Mark Rudolph CmuSmMphIsIXAUIs or (303)692-  3311).  6Ina Consent Decree (No, 18-md-02824-WJ) with the United States and CDPHE, Sunnyside Gold Corporation (SGC) agreed to provide EPA, Colorado, and their contractors with access to SGC property within the Site for the performance of response actions. In thes same Consent Decree, SGC agreed that it would require any transferee of the property "to agree to comply with, and be bound by." the same access provisions. EPA understands that the access requirements from the 2022 Consent Decree willl be conferred to! SJC in: ap property transfer agreement executed between SGC and SJC. CERCLA S 101(40)(B)(iv) provides that "The person exercises appropriate care with respect to hazardous substances found at the facility by taking reasonable steps to () stop any continuing release; (ii) prevent any threatened future releases; and (ii) prevent or limit human, environmental, or natural resource exposure to: any previously released hazardous substance."  4    Conclusion  The EPA remains dedicated toi facilitating the cleanup and beneficial reuse of contaminated properties and hopes the information contained in this letter is useful to you. You may find it helpful to consult with your own environmental professional, legal counsel, and your state, tribal, orl local environmental protection agency before taking any action to acquire, clean up, or redevelop the Properties. These consultations may help you obtain a greater level of comfort about the compatibility of the proposed use and ensure compliance with any applicable federal, state, local, and/or tribal laws or requirements. If you have any additional questions or wish to discuss this information further, please contact Joy. Jenkins  Gynkimsjuyrspigo or 720-951-0793).  Sincerely,  Joy. Jenkins Remedial Project Manager  Optional: Appendix A: Property List cc: Mark Rudolph, State Project Manager, CDPHE  Jason King, Assistant Attomey General, Colorado Attorney General's Office  5    Appendix A- Properties locatedi in San. Juan County Sunnyside Gold Corporation Property List Claimso or Sites Includedi inp Parcel,  Parcel/TaxID: #47730190030005 #47730190030006 #47730190050004 #47730300020001 #47730300020002 #47730300020003 #47730300020004 #47750100050003  EUREKA TOWNSITE LOT5 5/ ACCORDING TOT THEF RECORDED BOUNDARY, ADJUSTMENT THEREOF FILEDF FORF RECORD SEPTEMBER EUREKA TOWNSITEI LOTE 6A ACCORDING TOT THEF RECORDED! BOUNDARY. ADJUSTMENT THEREOF FILED FORF RECORD SEPTEMBER CASHIER LODE -MS 134 (UNDS 9/101 INTI INI 10,5ACRES), CENTENNIAL- MS1 16635, NASBY- MS 2508, ROVING RANGERI LODE- EUREKA TOWNSITEI LOT 1ACCORDING TOT THE RECORDEDI BOUNDARY. ADJUSTMENT THEREOF FILED FORI RECORD SEPTEMBER EUREKA TOWNSITEI LOT 3A ACCORDING TOT THE RECORDEDI BOUNDARY, ADJUSTMENT THEREOF FILED FORI RECORD: SEPTEMBER  30,2 2011 ASF RECEPTION #148168 30, 2011 ASF RECEPTION #148168 MS 151 A, TAGNER- MS 16804, WHITE STAR MS 14368 30, 2011 AS RECEPTION #148168 EUREKA TOWNSITE LOT2A ACCORDING TOT THE RECORDEDE BOUNDARY ADJUSTMENT THEREOF FILED FORF RECORD SEPTEMBER: 30, 2011 ASR RECEPTION: #148168 30, 2011 #148168 EUREKA TOWNSITEI LOT 4ACCORDING" TOT THEF RECORDED1 BOUNDARY ADJUSTMENT THEREOF FILED FOR REÇORD SEPTEMBER: 30, 2011 #148168  #47750090050001 CASHIER MS 442, ORIENTAL- -MS5 566, PRIDE OFT THE ALPS-MS5 572 #47750100050051 TAGGART -MS 2338 (UND: 1/31 INTI IN7,22ACRES)  EMMA- MS 2273, LULU CARROLL- MS 873, MOTHER GOOSE -MS17234, MOULTRIEI LODE -MS1 173, PAYMASTER- MS 1301, PALOS- MS 18732, PALOS# #1-MS 18732, PALOS #2- MS 18732, SUNNYSIDE #2- MS 20003, SUNNYSIDE EXT-MS1180, TERRY- MUSKEGON MS 1394, RARUS MS 1401, NANTUCKET- MS 6954 (UND! 5/12 INT IN1 10.28A ACRES), DENVER- MS 1403, ALMA- REPUBLIC- MS 12724, RUBY- MS1 18020, SHOSHONE MS 17201, SILVER BOW- MS1 18020, SUNNYSIDE MS 438, SUNNYSIDE ANNEX- MS 16668, THUNDERBERG- MS 1395, WEDGE- MS 18160, ANACONDA- MS 18020, BAVARIAN MS 1396, BRIGGS- 20003, LAKE MS 2027, LAST CHANCE MS1 17901, LITTLE MARY MS 2038, METROPOLIS MS 1398, PEARL- MS 5975, QUAIL  PONY MS 2336 (UND 2/31 INTI IN8.1 10A ACRES)  #47750100050031 MIDNIGHT MS 5616  #47750110050002 MS 17986, MASTODON- MS2 216, NO NAME MS 2272, CROWN. JEWEL MS 20003, DOCTOR MS 2093A, ESMARALDA- -MS  16165. GOLDE PRINCE -MS2 20003 MS1 1708, CHARLTON- MS 1706  #47750110050022 FEARLESS MS1 17011  #47750130050001  #47750130050003 CLIMAX #3- -MS 19474, TIPT TOP- -MS 18108, TIPT TIP! #2-MS 19474, TIP TOP#3-MS: 19474  #47750140050002 MS 8400, BUTTE CITY- MS 18020, CLIMAX- MS 12723, CLIPPER-MS: 1689, HERMAN MS1 1397, HIDDEN TREASURE EXT-MS #47750150050001 GEORGE WASHINGTON: MS 2028, GRANDI VIEW- MS 17202, MOUNTAIN: SHEEP MS 17432, OREGON- MS 17233  MS 20003 RAYMOND- MS.18020  #47750150050002 HONECK- MS 16200, SILVER KING MS 1857 47750150050011 PAYMASTER- MS 18080, WATERLOO -MS 17429 #47750160050006 EMMA #1-MS 17538, EMMA #2- MS 17538, SMUGGIFR- -MS1 1758  AMA- MS 18849, BLUE HEEL-MS 18849, DOVER- MS 1690, GOLDI PEAK-MS 16393, JOE-MS1 18849, MILANO-MS 16393, RED ADSEARL- MS 1714, DANEBURG MS 1780, HILDERBRAND- MS 1707, KNICKERBOCKER- -MS: 1717, UNDERWOOD- MS 1719 BLUCHER- MS 1400, EIGHTY NINE MS 16997, ESTEY-MS 13189, LIZZIE NORRIS MS 1702, GRAND- MS 2573, GRAND PRIZE MS 1701, GREAT EASTERN- MS 1691, NEWY YORK- MSS 8399, WELLINGTON- MS1 16997, SUNBEAM- MS1419 SUNNYSIDE GOLD CORPORATION- PERINO BOUNDARY: ADJUSTMENT PARCEL C, REÇORDED. ASF RECEPTIONI NO. 151146, IN RECEPTION NO. 186140. FORMERLY PARTO OFS SCHEDULES 48290090010003. AND 48290090010036. METES ANDI BOUNDS SUNNYSIDE GOLD CORPORATION- PERINO BOUNDARY ADJUSTMENT PARCELE E, RECORDED. ASF RECEPTIONI NO. 151146, IN FORMERLYPARTOES SCHEDULE 48290090010031AND: 48290090010032. METESA ANDB BOUNDS OMITTED. SUNNYSIDE GOLD CORPORATION- PERINO BOUNDARY. ADJUSTMENTI PACELF F, RECORDED/ ASR RECEPTION NO. 151146, IN AND BLM TRACT41. FORMERLY PART OFS SCHEDULE 48290090010031. AND4 48290090010032. METESA ANDE BOUNDS OMITTED. BLAIR PLACER- MS 841, GOLD -MS 14012, JEANNETTE! ROUXE PLACERI MS 11596 MINERAL RIGHTS ONLY, RIVERSIDE (PART)-MS BUENA VISTA MS1 14012, MBN MILLSITE- MSZ 20595 B,NNM MILLSITE- MS 20595 B,T THWN MS TRACTA A- MS 20595 B,TH HWMS  #47750220050003 MS 18849, ROCK- MS 18849, ROSA- MS 18849, ROSSO-MS: 18849, ROUENA 0- MS 16393, TREASURE MS 18849, YANKEE  BOY- -MS18849  #47750230050001 BEAUBREC- MS 1709  #47750230050002 #47750240050001  #48290090010033 BEND PLACER- MS 11596, CHN MILL SITE MS 20594. FORMERLY PART OF SCHEDULE 48290090010031 #48290090010039 SUSPENDED T41NR7W. FORMERLYI PART OF ANN HARRIS PLACER- MS 11596A AND FORMER PARCEL BB, RECORDED/ AS #48290090010041 SUSPENDED T41NR7W FORMERLY PORTIONS OF MDT THATCHER- M51 17699 ANDF POLAR STARI MILL SITE- MS 7608 #48290090010042 SUSPENDED T41NE R7W: FORMERLY PART OFP PETER PLACER- MS 11596, AND! SMALLI PORTIONS OFI MD1 THATCHER- MS 17699  OMITTED.  #48290090010043 #48290100010006  8801,HVBI MILL SITE- MS 20594B. FORMERLY PART OF SCHEDULE 4B290090010003  4829090010044 TRACT542,43,44,45, ANDP PARCEL DDI IN T41NR7W  TRACTB- MS 20595B    From: To: Cc: Subject: Date: Attachments: Hi Anthony and' Willy,  Jenkins. Joy Anthony Edwards; William Tookey San Juan County Reasonable Steps/Comfort Letter Friday, March3 31, 20234 4:30:00PM San) Juan County Comfort Letter 3-31-2023.pdf  markndalnnesateco.s, ason.ingBcoan.o Lindsey.Willam; Naftz.D Douglas  Please deliver the attached EPA Reasonable Steps/Comfort Letter to the San. Juan Board of County Commissioners. Please continue communication with EPA: and CDPHE on the future intended uses oft the properties and we willl be happyt to discuss compatibility with the current ori future remedies.  Have a good weekend! Joy Joy, Jenkins, Ph.D., P.E. Environmental Engineer Remedial Project Manager Superfund Remedial Branch (8SEM-RB-5B) U.S EPA Regions 8 1595 Wynkoop Street Denver, Colorado 80202 Mobile 720-951-0793 Office 303-312-6873 E-mail: .0/Ban12    PHASEIENVIRONMENTAL SITE ASSESSMENT REPORT Sunnyside Gold Corporation Mining Claim Parcels Silverton, San Juan County, Colorado, 81433  Prepared by  SH Environmental Consulting LLC Arvada, Colorado 80004  ENVIROMMENTALCONSLLTINGUIC  SHA    July 8, 2024 William Tookey County Administrator San. Juan County P.O. Box 466 Silverton, Colorado, 81433  Re: PhaselE Environmental Site Assessment Sunnyside Gold Corporation Mining Claim Parcels San. Juan County, Colorado, 81433  Dear Mr Tookey,  SH Environmental Consulting, LLC performed this Phase I Environmental Site Assessment (ESA) in conformance with the scope and limitations of ASTM E2247-16, Standard Practice for Environmental Site Assessment Process for Forestland or Rural Property of the Sunnyside Gold Corporation (SGC) mining claim This Phase IE ESA did not reveal evidence of Recognized Environmental Conditions (RECs) in connection with This Phase I ESA did not reveal evidence of Historical RECs in connection with the Properties.  parcels located in San Juan County, Colorado (Properties).  the Properties.  This Phase I ESA revealed evidence of Controlled RECS in connection with the Properties. The Properties are located entirely in a United States Environmental Protection Agency (EPA) Superfund designated area. Accumulated mining activities in the area resulted in contamination of heavy metals and sediments that impacted the soil, groundwater, and surface water over three drainages in the watershed. Due to this contamination, the EPA listed the area as the Bonita Peak Mining District Superfund site and added it to the Environmental investigations and remedial actions have been performed to reduce or eliminate metal loading in the waterways. Based upon the San Juan County Assessor's Property and Map Search website on May 24, 2024, and interviews with the Colorado Department of Public Health and Environment, the SGC Properties have been remediated to the extent required by the regulations of the Bonita Peak Mining District Superfund. While these Properties have been remediated to the extent required by regulation for the Superfund listing, the Propertles have not been remedlated for unrestricted use. Therefore, the Superfund According to ASTM E2600-15, based upon the absence of known or reported hazardous chemicals or volatile organic compounds released to the Properties or surrounding immediate area, a vapor encroachment lappreciate the opportunity to provide these services for you. Please contact me at (970)215-5303 or at  National Priorities List on September 9, 2016.  listing is considered a CREC in connection with the Properties.  condition can be ruled out.  shenvironmental.conoutlook.com if you have any questions or comments.  Sincerely,  SH Environmental Consulting, LLC a EH Steven B. Hoffman, P.G. Environmental Professional    Table of Contents Project Summary. 1.0 INTRODUCTION 1.1 Scope of Services. 1.2 Limiting Conditions 1.3 Deviations and Exceptions. 1.4 Significant Assumptions. 1.5 Special Terms and Conditions 1.6 User Reliance. 2.0 SITE INFORMATION. 2.1 General Description and Site History. 2.2 Property Description.. 2.3 Regulatory Filings. 2.4 Physical Settings.  - 2 2 3 3 3 3 3 4 4 5 6 7 9 9 10 10 10 26 27 27 29 29 30 31 32 33  2.5 Current Uses of Adjoining Properties 3.0 USER PROVIDED INFORMATION 3.1 Additional Information 4.0 RECORDS REVIEW. 4.1 Regulatory Report Summary 4.2 Historical Resources Reviewed.  4.3 Historical Use Information on the Subject Property. 4.4 Historical Use Information on Adjacent Properties  4.5 Data Gaps/Data Failure. 5.0 SITE RECONNAISSANCE. 6.0 INTERVIEW'S. 7.0 EVALUATION 9.0 REFERENCES.  8.0 ENVIRONMENTAL PROFESSIONAL'S: STATEMENT..    TABLE OF APPENDICES Figure 2 Site Detail Figure 3 Parcel Map  Appendix A, Figure 1 Site Location/Iopographic Map  Appendix B Mining Claim Parcel List Appendix C Regulatory Filings Appendix D County Assessors Information Appendix E Physical Settings Report Appendix F User Questionnaire Appendix G Database Report Appendix H Aerial Photographs Appendix/Historical Topographic Maps Appendi/Photographs Appendix KS SGC Regulatory Correspondence AppendkLQualifcations    Project Summary  SH Environmental Consulting, LLC (SH Environmental) performed this Phase IE Environmental Site Assessment (ESA) of the Sunnyside Gold Corporation (SGC) mining claim parcels located in San Juan County, Colorado This Phase I ESA did not reveal Recognized Environmental Conditions (RECs) in connection with the This Phase IE ESA did not reveal evidence of Historical RECs (HRECs) in connection with the Properties, This Phase I ESA revealed evidence of Controlled RECS (CRECS) in connection with the Properties. The Properties are 124 mining claims located on 31 parcels over approximately 1,202 acres that were part of active mining in the County from the 1870s until 1991. Over 400 abandoned or inactive mines are present in the area where the Properties are located. As a result of this collective mining activity, contamination from heavy metals and sediments impacted the soil, groundwater, and surface water that were dispersed over three drainages. Due to this contamination, the United States Environmental Protection Agency (EPA) listed the area as the Bonita Peak Mining District Superfund site and added it to the National Priorities List on According to the Colorado Department of Public Health and Environment, the SGC mining claim parcels have been investigated and. remediated to the. extent required by the EPA. The SGC portals and adits have been secured in compliance with the Colorado Division of Reclamation, Mining and Safety regulations. As outlined in the Consent Decree issued by the United States District Court for the District of New Mexico and filed April 29, 2022, the SGC Properties included in this ESA have been remediated to the requirements of and in compliance with EPA regulations and monetary settlements to affected stakeholders by SGC have Additional environmental assessment and remedial actions will be performed by the EPA and as required by the Intern Record of Decision (May 2019) and the Adaptive Management Site Management Plan (November  (Properties) at the request oft the San. Juan County Board of Commissioners.  Properties.  September 9, 2016.  been fulfilled.  2020) toi further address the following: Water discharge from the Terry Tunnel; Mayflower Mill tailings pile 4; and  Groundwater treatment remedial investigation and feasibility study.  Pursuant to ASTM E2600-15 and based upon the absence of known or reported hazardous chemicals or volatile organic compounds released to the Properties or the surrounding immediate area, a vapor  encroachment condition can be ruled out.  July 2024  SH Environmental Consulting, LLC    No Further Action  Other Environmental Considerations  Report Section  REC  CREC / / /  HREC  3.0 USER PROVIDED INFORMATION 4.0 RECORDS REVIEW 4.3 Historical Use Information on the Subject Property 4.4 Historical Use Information on Adjacent Properties 5.0SITE RECONNAISSANCE 6.0 INTERVIEW'S  /  1.0 INTRODUCTION  SH Environmental Consulting, LLC was retained by the San Juan County Board of Commissioners (User), to perform a Phase I Environmental Site Assessment (ESA) of 124 mining claim parcels located on 31 parcels over approximately 1,202 acres in San Juan County, Colorado (Figures 1, 2 and 3, Appendix A). A listing of these parcels (Properties) is provided in Appendix B. It is with the understanding that these Properties are owned by the Sunnyside Gold Corporation (SGC), which would like to transfer ownership to San Juan County. The User has requested this Phase IESA to identify potential Recognized Environmental Conditions (RECs), as defined by ASTM Standard E2247-16, in connection with the Properties and to satisfy one of the requirements to qualify for the innocent landowner, contiguous property owner, or bona fide prospective purchaser limitations under the Comprehensive Environmental Response, Compensation and Liability Act (CERCLA) (42 U.S.C. $9601) (hereinafter, the "landowner liability protections," or "LLPS"). The methods used for this ESA are in conformance with ASTM E2247-16, Standard Practice for Environmental Site Assessments: This ESA included personal interviews, background research of legal filings in connection with the Properties, reviewing regulatory database reports, historical aerial photographs, topographic maps, available local, state, and federal regulatory records regarding the presence of petroleum products and/or hazardous Environmental Risk Information Services (ERIS) was contracted to perform a computer database search for local, state, and federal regulatory records pertaining to environmental concerns for the Properties and Services rendered were completed in accordance with the standard practice guidelines established in ASTM E2247-16, Standard Practice for Environmental Site Assessments: Phase I Environmental Site Assessment Process, for Forestland or Rural Property and the United States Environmental Protection Agency'sStandards  PhaselE Environmental Site Assessment Process for Forestland or Rural Property.  materials and reconnaissance of the Properties and adjacent properties.  properties in the vicinity (see Section 4.0).  and Practices for All Appropriate Inquiries (AAI), 40 CFR, Part 312.  1.1 Scope of Services  The scope of services was to perform a Phase I ESA in a manner consistent with ASTM E2247-16. A Phase I ESA is intended to inspect a property with respect to petroleum products and the hazardous substances listed in CERCLA (42 U.S.C. $9601). A Phase I ESA is not intended to take place or be considered an  environmental or regulatory compliance inspection.  July2024  SHE Enronmengiconumns. LLC    This Phase IE ESA was conducted to provide a reasonable level of investigation to identify RECS in connection with the Properties. As defined by the ASTM standard, the term "REC" means the presence or likely presence of any hazardous substances or petroleum products in, on, or at a property: (1) due to any release to the environment; (2) under conditions indicative of a release to the environment; or (3) under conditions that pose a material threat of a future release to the environment. De minimis conditions are not recognized A Controlled REC (CREC) is a REC affecting a property that has been addressed to the satisfaction of the applicable regulatory authority or authorities with hazardous substances or petroleum products allowed to A Historical REC (HREC) pertains to a previous release of hazardous substances or petroleum products affecting a property that has been addressed to the satisfaction of the applicable regulatory authority or authorities and meeting unrestricted use criteria established by the applicable regulatory authority or  environmental conditions.  remain in place subject to implementation ofr required controls.  authorities without subjecting the property to any controls.  1.2 Limiting Conditions  The findings and conclusions contain all the limitations inherent in the methodologies that are referred to in ASTM E2247-16. Limitations or exceptions encountered during the completion of this ESA occurred due to the rugged mountainous terrain preventing a physical inspection of some parcels. Generally, the parcels that  were not physically inspected were observed using telescopic equipment.  1.3 Deviations and Exceptions  There were no notable deviations or exceptions from the scope of work.  1.4 Significant Assumptions  There is a possibility that even with the proper application of these methodologies, there may exist on the Properties, conditions that could not bei identified within the scope of the ESA, or which were not reasonably identifiable from the available information. It is believed that the information obtained from the records review and the interviews concerning the Properties is reliable. However, SH Environmental Consulting cannot and does not warrant or guarantee that the information provided by these other sources is accurate or complete. The methodologies of this ESA are not intended to produce all-inclusive or comprehensive  results, but rather to provide San. Juan County with information relating to the Properties.  1.5 Special Terms and Conditions  The conclusions and findings set forth in this report are strictly limited in time and scope to the date of the evaluations. The conclusions presented are based solely on the information described and not on scientific tasks or procedures beyond the scope of agreed-upon services. No subsurface exploratory drilling or Some of the information provided is based upon personal interviews, and research of available documents, records, and maps held by the appropriate government and private agencies. This information is subjectt to the limitations of historical documentation, availability, and accuracy of pertinent records, and the personal  sampling were performed under the scope of this work.  recollections of those persons contacted.  1.6 User Reliance  The findings, opinions, and conclusions of this Phase I ESA are for the confidential and exclusive use of San Juan County, its affiliates, employees, agents, successors, and assigns. Reliance on this Phase I ESA for any use by parties other than specifically stated is prohibited without the express written consent of SH  Environmental Consulting and the San. Juan County Board of Commissioners.  July 2024  SH Environmental Consulting, LLC    2.0 SITE INFORMATION  2.1 General Description and Site History  The Properties are located in northeast San Juan County and consist of 31 parcels, with 124 mining claims, over approximately 1,202 acres. These parcels are located east of San Juan County Road 110 and north of San. Juan County Road 2 and are owned by SGC. Site Location Maps are provided as Figures 1 and 2 and the parcels included in this ESA are illustrated on Figure 3 (Appendix A). A listing of the parcels and associated Mining began in San Juan County in the 1870s and ended in 1991 when the Sunnyside Mine ceased operation. The Sunnyside Mine was the last significant mining operation in the. Bonita Peak Mining District (BPMD) and was the largest and most productive mine in the area. The Sunnyside Mine is situated at the headwaters of Eureka Gulch near historic Lake Emma at an approximate elevation of 12,320 feet. SGC operated the Sunnyside Mine from 1985 to 1991 and acquired ownership of the Mine in 1992. As a result of mining in the BPMD, contamination to soil, groundwater, and surface water from heavy metals and sediments were dispersed over three drainages in the watershed. Over 400 abandoned or inactive During the 1990's the EPA and the Colorado Department of Public Health and Environment (CDPHE) conducted a site assessment of the mining areas. This assessment identified severe impacts to aquatic life in the Upper Animas River and its tributaries from heavy metals. SGC and the Colorado Water Quality Control Division entered into a Consent Decree on May 8, 1996, which resolved litigation related to the State's Water On September 9, 1996, the Bonita Peak Mining District Superfund site was added to the National Priority Pollutant List (NPL). Between 1996 and 2004, SGC installed 11 bulkheads within the Sunnyside Mine to stop the uncontrolled flow of water from the Mine. During this time period, other mine portals and adits associated with SGC were closed and safety secured in accordance with Colorado Division of Reclamation, Mining and Safety (DRMS) regulations. These closures have been inspected for compliance by From 2005 through 2014, SGC, EPA, the United States Bureau of Land Management, and the state of Colorado conducted remedial investigation and reclamation activities in the Upper Animas Watershed. These efforts have included diverting water runoff and capping mine waste piles, moving mine waste piles away from drainages, consolidating mine waste piles, creating sediment retention ponds, placing bulkheads in  claims is provided in Appendix B.  mines are present in these three drainages.  Quality Control Act.  representatives of the state of Colorado and the EPA.  draining adits, and re-vegetating mine waste piles. The BPMD is organized into five operable units (OUs): Mayflower Mill and Tailingss Study Area.  - OU1: Site-wide- 0U1 encompasses the entire Bonita Peak Mining District Superfund site. OU2: Mayflower - OU2 includes the Mayflower Tailing Ponds No. 1, No. 2, No. 3, and No. 4 and the OU3: Bonita Peak Groundwater. System - OU3 generally includes the saturated and unsaturated workings of the Sunnyside Mine, associated drainage and haulage tunnels, nearby mines not known to be connected to the Sunnyside Mine workings (e.g. Red & Bonita Mine and Gold King Mine), and the surrounding geographic area that may be hydraulically connected or influenced by current and/or 0U4: Ben Franklin Mine The Mine is located immediately below and east of the confluence of the two OU5: London Mine Located north of Burrows Creek, a tributary to the North Fork of the Animas River. During an inspection of the Gold King Mine outer bulkhead by EPA personnel on August 5, 2015, a release from the Mine of approximately 3 million gallons of water containing metals and sediments occurred. This discharge entered into Cement Creek which is a tributary to the Animas River. SGC entered into a Consent  historical releases from or due to the management of these mines.  headwaters of Eureka Gulch.  July 2024  SHE Environmental Consulting LLC    Decree with the United States District Court for the District of New Mexico on May 11, 2017, for this The EPA issued a "Unilateral Administrative Order for Remedial Investigation" on March 18, 2018, for investigation of the Groundwater System identified as OU3. Under this Order, EPA performed remedial investigation and feasibility studies that identified 48 mining related source areas of contamination from historic hard rock mines, tailings, and waste rock within Mineral Creek, Cement Creek, and Upper Animas River drainages. These areas include 35 mines, seven tunnels, and four tailings impoundments. Known contaminants associated with both waste rock and water discharges from adits include arsenic, cadmium, The EPA signed an Interim Record of Decision (IROD) for OU1 on May 20, 2019 that identified 23 source areas and two dispersed campgrounds for interim remedial actions (IRAs). These IRAS included stabilization The EPA adopted an Adaptive Management Site Management Plan (AMP) for the Bonita Peak Mining District in November 2020 to provide the framework for decision making for the continuous planning, remedial implementation, and assessments to prioritize and manage environmental processes in the BPMD. San. Juan County Ordinance Number 2020-01 was adopted on December 15, 2020, for the regulation of land use within the BPMD. This ordinance establishes San Juan County with jurisdiction over Mine Waste Source Areas to control and regulate land use within unincorporated San Juan County where residual mine waste and remediation components exist, specifically the BPMD Superfund site. According to the Ordinance, the EPA and CDPHE have performed and will continue to conduct CERCLA response actions including, but not limited to, response actions selected in the IROD and possible other future CERCLA response actions, at portions of the BPMD Superfund site (collectively referred to as "CERCLA response actions"). SGC satisfied the requirements of the Consent Decree and was released of further environmental liability associated with these Properties, as filed on April 29, 2022, with the United States District Court for the  incident.  copper, manganese, and zinc.  oft the mine source areas and measures to reduce contaminant loading to surface waters.  District of New Mexico.  A copy oft the regulatory documents is provided in Appendix C.  2.2 Property Description  San Juan County Assessor's parcel information is provided in Appendix D. A summary of the assessor's parcel  numbers, acreages, and remedial status is listed below.  Parcel ID  Acreage  Ordinance 2020-1 Remedial Status  47730190030005 47730190030006 47730190050004 47730300020001 47730300020002 47730300020003 47730300020004 47750090050001 47750100050003 47750100050031  17.7 13.8 51.34 41.65 93.36 23.84 19.32 25.28 42.49 8.0 5  Remediated Remediated Remediated Remediated Remediated Remediated Remediated Remediated Remediated Remediated  July 2024  SHE Environmental Consulting, LLC    Parcel ID  Acreage  Ordinance 2020-1 Remedial Status  47750100050051 47750110050002 47750110050022 47750130050001 47750130050003 47750140050002 47750150050001 47750150050002 47750150050011 47750160050006 47750220050003 47750230050001 47750230050002 47750240050001 48290090010033 48290090010039 48290090010041 48290090010042 48290090010043 48290090010044 48290100010006  2.41 89.17 9.74 43.92 26.11 194.92 35.66 17.43 18.9 24.26 133.44 10.33 44.27 89.19 22.73 32.83 5.91 12.66 38.14 10.33 23.43  Remediated Remediated Remediated Remediated Remediated Remediated Remediated Remediated Remediated Remediated Remediated Remediated Remediated Remediated Remediated Remediated Remediated Remediated Remediated Remediated Remediated  2.3 Regulatory Filings  A summary of significant regulatory filings by the EPA and the states of Colorado and New Mexico on the SGC Properties is provided below. This is not a listing of all regulatory filings pertaining to the Properties. A - May 8, 1996: Consent Decree between SGC and the Colorado Water Quality Control Division, for the September 9, 2016: The EPAI lists the area as the Bonita Peak Mining District Superfund site and added it May 11, 2017: The EPA and SGC enter into an Administrative Settlement Agreement and Order on March 15, 2018: A Unilateral Administrative Order for Remedial Investigation is issued by EPA for May 20, 2018: Interim Record of Decision for the BPMD Superfund Site Operable Unit 1 San. Juan County,  copy of the documents is provided in Appendix C.  resolution of litigation related to the State's Water Quality Control Act.  tot the National Priorities List. Consent for Remedial Investigation.  November 15,2016: State of New Mexico files Motion V. EPA, ET AL-i includes SGC.  investigation of the Groundwater System as Operatable Unit3.  Colorado. July 2024  SHE Environmental Consulting, LLC    September 3, 2020: Administrative Order Directing Compliance with the Request for Access to the November 2020: Adaptive Management Site Management Plan for the BPMD San Juan County, Colorado December 15, 2020: San Juan County Ordinance Number 2020-01 for the regulation of land use within December 10, 2021: Consent Decree, United States District Court for the State of Colorado, The State of Colorado Through the Colorado Natural Resources Trustees V. Sunnyside Gold Corporation. April 28, 2022: Consent Decree, United States District Court for the District of New Mexico, Case 1:18- June 14, 2022: Settlement Agreement Between New Mexico and the US (re State of New Mexico V.  Mayflower impoundment area.  isadopted. the BPMD.  md-02824-W, Document 1634.  USEPA, etal,116-cv-00465) ("the New Mexico Action").  2.4 Physical Settings  Physical Setting Sources  Physical setting source information is included in Appendix E  Surface Water:  During the site reconnaissance in June 2024, stormwater runoff was not observed. Based upon the local slope oft the individual Properties ini this mountainous terrain, runoff will occur from the higher elevations to the lower elevations and ultimately to thei tributaries draining into the Animas River. A review oft the National Wetlands Inventory Map published by the United States Department of the Interior, Fish and Wildlife  Service, revealed the following parcels that are in a wetlands designated area:  Parcel  Designation  47730190030005 47730300020001 47730300020002 47730300020003 47730300020004 47730300020005 47750090050001 47750140050002 47750150050001 47750150050002 47750230050001 47750240050001 48290090010033 48290090010039 48290090010041  Portions of this parcel are located in al Freshwater Pond area. Portions of this parcel are located in a Freshwater Pond area. Portions of this parcel arel located in a Freshwater Pond area. Portions of this parcel are located in a Freshwater Pond area. Portions of this parcel arel located in a Freshwater Pond area., Portions of this parcel are located in al Freshwater Pond area. Portions of this parcel arel located in a Freshwater Emergent Wetlands. Portions of this parcel arel located in Freshwater Emergent Wetlands and Freshwater  Pond areas.  Portions of this parcel are located in al Freshwater Pond area. Portions oft this parcel arel located in al Freshwater Pond area. Portions of this parcel are located in al Freshwater Pond area. Portions of this parcel are located in al Freshwater Pond area. Portions of this parcel are located in al Freshwater Pond area. Portions of this parcel are located in af Freshwater Pond area.  Portions of this parcel are located in Freshwater Emergent Wetlands and Freshwater  Pond areas.  July 2024  SHE Environmental Consulting, LLC    Parcel  Designation Pond areas.  48290090010043 48290090010044 Geology:  Portions oft this parcel are located in Freshwater Emergent Wetlands and Freshwater  Portions of this parcel are located in al Freshwater Pond area.  The San Juan Mountain Range consists of geologic units that range in age from Precambrian crystalline rocks to late Cenozoic deposits of the San Juan volcanic field. The San Juan Mountains were created during tectonic building as two continental plates came together that pushed mountain peaks to over 14,000 feeti in elevation. These tectonics resulted in volcanic activity with magma that produced rich veins of gold and silver deposits. During numerous periods of volcanic activity, andesitic lava and ash filled the valleys and fissures. After the eruptions ended, the pools of subsurface magma shrank, creating calderas and valleys. The mountain sides and valleys were then cut by glaciers during the Eocene and the three glaciation periods in the Quaternary Period. The current topography is the erosional remnant of the Oligocene-age San Juan  volcanic field cut by glaciers. Surficial Soils:  The soils over the Properties include multiple units that are indicative of mountainous terrain. These soils include the Cryorthents-Rubble land complex consisting of well drained colluvium and slope alluvium derived from rhyolite with 30 percent to 75 percent slopes. Other soils include the Whitecross stony-rock outcrop complex units derived from volcanic rock and ash consisting of very stony sandy loam to extremely gravelly sandy loam and rubble consisting of fragmental materials with slopes between 15 percent to 75  percent. Hydrology:  The Properties are in the Dolores/San Juan River Basin that covers an approximate area of 10,169 square miles. The headwaters of both the San Juan and Dolores Rivers begin in the San Juan Mountains at an elevation between 13,000 feet and 14,000 feet, according to the Colorado Water Conservation Board (CWCB) and the Colorado Department of Water Resources (DWR). The San Juan River originates north of Pagosa Springs and flows southwest to an elevation of 4,800 feet before entering New Mexico, and then into Utah where it joins the Colorado River. The Dolores River is located north of the San Juan River and south of the Town of Telluride and flows southwest to McPhee Reservoir. The river then flows northwest to an Major tributaries to the San Juan River include the Navajo, Piedra, Los Pinos, Animas, Florida, La Plata, Rio Blanco, and Mancos Rivers, and McElmo Creek. Major tributaries to the Dolores River include the West Fork of the Dolores, the San Miguel Rivers, Lost Canyon, Disappointment, and West Paradox Creeks. Major reservoirs in the Dolores/San Juan Basin include the McPhee, Vallecito, Lemon, Cascade, Groundhog, and Groundwater flow and depth under the Properties is highly variable due to the mountainous terrain. Groundwater flow and depth is influenced by subterrain pressures and bedrock fractures. Groundwater  elevation of 4,100 feet asi it enters Utah where it joins the Colorado River.  Narraguinnep Reservoirs.  flows through the bedrock ini these fractures.  Flood Zones:  Flood zone maps have not been created for this area.  July 2024  SHE Environmental Consulting, LLC    PSR Radon  Area  Description  Federal EPAI Radon Zone for OURAY County Zone 1: Counties with predicted average indoor radon screening  levels greater than 4 pCi/L levels from 21 to 4 pCi/L  Federal EPAI Radon Zone for SAN JUAN  Zone 2: Counties with predicted average indoor radon screening  County Other:  According to the ERIS Physical Setting Report dated May 24, 2024, No oil or gas wells have been constructed or permitted on the Properties or within a % mile radius. There are no oil or gas pit locations on the According to the ERIS Physical Setting Report, the Water Wells Permit Database lists 131 registered water wells constructed or permitted on either the Properties or within a % mile radius of the Properties. The United States Geological Society has 59 monitoring wells registered on or within % mile radius of the  Properties or within % mile radius.  Properties.  2.5 Current Uses of Adjoining Properties  Current Use  Direction from Subject Property North East South West  Undeveloped mountainous terrain with remnants of former mining Undeveloped mountainous terrain with remnants of former mining Undeveloped mountainous terrain with remnants of former mining activities. San. Juan County Road 2 running east and west along the Undeveloped mountainous terrain with remnants of former mining activities. San Juan County Road 110 running north ands south.  activities. activities.  Animas River to Silverton.  The Properties are located within the Bonita Peak Mining District Superfund site and the surrounding properties are part of the Superfund listings. Therefore, observations of the adjoining properties revealed evidence of former mining activities and remedial efforts to stabilize and reclaim the former mining parcels.  3.0 USER PROVIDED INFORMATION  SH Environmental requested that a representative of the purchaser complete the User Questionnaire (Appendix F). On behalf of San. Juan County, Anthony Edwards completed the questionnaire on June 28, 2024  (User). The results oft the questionnaire are summarized below:  July 2024  SH Envronmentaiconunng LLC    Issue Identified (Y/N)  User Provided Information Environmental Liens, Activity, or Use Limitations  Comments  The area reviewed is included in a CERCLA designated site on the National Priority Listing. In addition, San. Juan County is aware the propertyi is subject to environmental covenants. In regards to local law, the property is subject San. Juan Countyi is aware of use limitations set forth in the institutional controls, land use restrictions and covenants required for the property within designated  toi institutional controls.  Engineered Controls  Yes  Superfund Sites.  Specialized Knowledge of the User Valuation Reduction for Environmental Issues Commonly Known or Reasonably Ascertainable Information Obvious Indicators of Environmental Impact  No No Yes  San. Juan Countyi is aware of the documentation, research and: sampling the Animas River Stakeholders, the State of Colorado, USGS, the Owner and EPAI have gathered and/ Some areas within the property boundaries include the remnants of historic mining activity. In regards to the tailings ponds (1-4) those areas contain waste rock and other contamination based on historic activity.  or prepared over the decades.  Yes  3.1 Additional Information  Fire insurance maps were not created for this area.  4.0 RECORDS REVIEW  Regulatory database information from federal, state, and local environmental record sources was provided by ERIS. The purpose of the records review was to identify potential RECS in connection with the Properties. Results of the database search in the ERIS Database Report found 183 listings (145 facilities) for the Properties and surrounding properties. Those identified listings are further discussed below within the applicable subsections. A copy of the database report dated May 28, 2024, is provided in Appendix G.  4.1 Regulatory Report Summary Database ASTM Type  Name  Company Name Site Site  Address Silverton CO 81433  Site On Facility Status Comments  BROWNFIELDS BROWNFIELD Brownfield Sites Lackawanna Mill 468 County Road 20 N  Not considereda RECin connection witht the Properties  July 2024  10  SHE Environmental Consulting, LLC    Database ASTM Type CERCLIS  Name Response, Compensation and Liability Information System - CERCLIS Response, Compensation and Liability Information System CERCLIS  Company Site Name  Address 81433  On Facility! Status Comments CON000802803 considereda  Site  CERCLIS Comprehensive MOGUL/GRAND CEMENT CREEK N Site EPAI ID:  Not RECin connection witht the Properties Not RECin connection with the Properties Considereda CRECin connection with the Properties Considereda CRECin connection with the Properties connection with the Properties connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection witht the Properties CRECin connection witht the Properties  Environmental MOGULMINE/S) SILVERTON CO  CERCLIS  CERCLIS Comprehensive RED/ AND COUNTY ROAD! 52 N Site EPAID:  Environmental BONITA MINE SILVERTON CO  CON000802811 considereda  81433  SHWS  CERCLIS EQUIV Superfund Sites Bonita Peak Multiple sources Y  Mining District near Animas River  headwaters UNINCORPORATED UNINCORPORATED CO CO  SHWS CERCLIS EQUIV Superfund Sites Bonital Peak  Y  Mining District  FED INST  CONTROLS  Federal Institutional Controls- ICs Federal Engineering Controls-ECs Data System  BONITA PEAK Muitiple sources Y  EPAID: Considereda CON000802497 CRECin EPAI ID: Considereda CON000802497 CRECin Dep ID: Considered: a 10119165  MINING DISTRICT MINING DISTRICT  near Animas River headwaters UNINCORPORATED CO81433 near Animas River headwaters UNINCORPORATED CO81433 SILVERTON CO 81433 SILVERTON CO 81433 SANJ JUAN COUNTY Y SILVERTON CO 81433 SILVERTONCO 81433 SILVERTON CO 81433  FED ENG  CONTROLS  BONITA PEAK Multiple sources Y  MRDS  MINE Mineral Resource UNKNOWN SAN. JUAN COUNTY Yy  MRDS  MINE Mineral Resource BLACK HAWKET SAN. JUAN COUNTY Y  Dep ID: Considereda 10107815  Data System  AL AZTEC  MRDS  MINE Mineral Resource  Dep ID: Considereda 10167745  Data System  MRDS  MINE Mineral Resource BARNES TUN SAN. JUAN COUNTY Y  Dep ID: Considered a 10265002  Data System  MRDS  MINE Mineral Resource TERRY1 TUNNEL SAN. JUAN COUNTY Y  Dep ID: Considereda a 10191718  Data System  July 2024  11  SHE Environmental Consulting, LLC    Database ASTM Type MRDS  Name Data System  Company Site Name  Address SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SAN JUAN COUNTY Y SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433  On Facility Status Comments Dep ID: Considereda 10018672  Site  MINE Mineral Resource BEN FRANKLIN SAN JUAN COUNTY Y  CRECin connection with the Properties CRECin connection witht the Properties CRECin connection witht the Properties CRECin connection witht the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECi in connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties  MRDS  MINE Mineral Resource BEN FRANKLIN SANJ JUAN COUNTY Y  Dep ID: Considereda 10143362  Data System  MRDS  MINE Mineral Resource SUNNYSIDE SAN. JUAN COUNTY Y  Dep ID: Considereda 10167210  Data System  MRDS  MINE Mineral Resource  LEAD  Dep ID: Considereda 10018661  Data System CARBONATE  MRDS  MINE Mineral Resource GRIVITZA, SAN. JUAN COUNTY Y  Depl ID: Considereda 10108456  Data System  MOUNTAIN EAGLE, NORMAN  MRDS  MINE Mineral Resource GOLDI KING SAN. JUAN COUNTY Y  Dep ID: Considereda 10018670  Data System  MRDS  MINE Mineral Resource UNKNOWN SAN JUAN COUNTY Y  Depl ID: Considereda 10288829  Data System  MRDS  MINE Mineral Resource GEORGE SANJ JUAN COUNTY Y  Dep ID: Considered: a 10264377  Data System WASHINGTON SILVERTON CO  81433  MRDS  MINE Mineral Resource GEORGE SAN. JUAN COUNTY Y  Dep ID: Considered: a 10018671  Data System WASHINGTON SILVERTON CO  81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433  MRDS  MINE Mineral Resource SILVER QUEEN SAN JUAN COUNTY Y  Dep ID: Considereda a 10107848  Data System  MINE  MRDS  MINE Mineral Resource NATALIE SAN JUAN COUNTY Y  Dep ID: Considereda 10143070  Data System  MRDS  MINE Mineral Resource UNKNOWN SAN JUAN COUNTY Y  Dep ID: Considereda 10289291  Data System  July 2024  12  SHE Environmental Consulting, LLC    Database ASTM Type MRDS  Name Data System  Company! Site Name  Address SILVERTONCO 81433 SILVERTON CO 81433 SILVERTONCO 81433 SILVERTON CO 81433 SILVERTONCO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433  On Facility! Status Comments Dep ID: Considereda 10143192  Site  MINE Mineral Resource MINNEHAHA SAN. JUAN COUNTY Y  CRECin connection with the Properties CRECin connection witht the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties  MRDS  MINE Mineral Resource GRIVITZA, SAN. JUAN COUNTY Y  Dep ID: Considereda 10143319  Data System  MOUNTAIN EAGLE  MRDS  MINE Mineral Resource KITTIMAC MINE SANJ JUAN COUNTY Y  Depl ID: Considereda 10018545  Data System  MRDS  MINE Mineral Resource SILVER BAY MINE SANJ JUAN COUNTY Y  Dep ID: Considereda 10009691  Data System  MRDS  MINE Mineral Resource BLACKHAWK, SAN JUAN COUNTY Y  Dep ID: Considereda 10107859  Data System OCCIDENTAL  MRDS  MINE Mineral Resource BLACKH HAWK SAN JUAN COUNTY Y  Depl ID: Considereda 10018662  Data System  MRDS  MINE Mineral Resource MINNEHAHA SAN JUAN COUNTY Y  Dep ID: Considereda 10107856  Data System  MINE  MRDS  MINE Mineral Resource MINNEHAHA SAN. JUAN COUNTY Y  Dep ID: Considereda 10018663  Data System  MINE  MRDS  MINE Mineral Resource TREASURE MTN. SAN. JUAN COUNTY Y  Dep ID: Considereda 10108249  Data System GOLDMINING SILVERTON CO  CO.  81433  MRDS  MINE Mineral Resource PRIDE OF SANJUAN COUNTY Y  Depl ID: Considereda 10018647  Data System BONITA GROUP SILVERTONCO  81433 SILVERTON CO 81433 SILVERTON CO 81433  MRDS  MINE Mineral Resource BURROWS- SAN. JUAN COUNTY Y  Depl ID: Considereda 10108450  Data System  LITTLE IOLA  MRDS  MINE Mineral Resource GOLDI PRINCE SAN. JUAN COUNTY Y  Dep ID: Considereda 10289152  Data System  July 2024  13  SH Environmental Consulting, LLC    Database ASTM Type MRDS  Name Data System  Company! Site Name  Address SILVERTON CO 81433 SAN JUAN COUNTY Y SILVERTONCO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTONCO 81433 SILVERTON CO 81433 SAN. JUAN COUNTY Y SILVERTON CO 81433 SILVERTON CO 81433  On Facility Status Comments Dep ID: Considereda 10167197  Site  MINE Mineral Resource NO NAME SAN. JUAN COUNTY Y  CRECin connection witht the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties  MRDS  MINE Mineral Resource  LEAD MINE  Dep ID: Considereda 10264986  Data System CARBONATE  MRDS  MINE Mineral Resource BLACK HAWK SAN. JUAN COUNTY Y  Dep ID: Considereda 10265018  Data System  MRDS  MINE Mineral Resource MIDWAY SAN. JUAN COUNTY Y  Dep ID: Considereda 10167630  Data System  MRDS  MINE Mineral Resource BENITOITE SAN. JUAN COUNTY Y  Depl ID: Considereda 10119446  Data System  MRDS  MINE Mineral Resource BELLE CREOLE SAN. JUAN COUNTY Y  Depl ID: Considereda 10264607  Data System  MRDS  MINE Mineral Resource UNKNOWN SAN. JUAN COUNTY Y  Dep ID: Considereda 10167148  Data System  MRDS  MINE Mineral Resource MOCKING BIRD SAN. JUAN COUNTY Y  Dep ID: Considereda 10167595  Data System  MRDS  MINE Mineral Resource WASHINGTON SAN. JUAN COUNTY y  Dep ID: Considereda 10216227  Data System  MRDS  MINE Mineral Resource HIDDEN SAN. JUAN COUNTY Y  Dep ID: Considereda 10108457  Data System  TREASURE  MRDS  MINE Mineral Resource HIDDEN  Depl ID: Considereda 10240501  Data System  TREASURE  MRDS  MINE Mineral Resource SILVER QUEEN SAN. JUAN COUNTY Y  Dep ID: Considereda 10018674  Data System  July 2024  14  SH Environmental Consulting, LLC    Database MRDS  ASTM Type  Name Data System  Company! Site Name MINE  Address SILVERTON CO 81433  On Facility! Status Comments Depl ID: Considereda 10119261  Site  MINE Mineral Resource BLACKHAWK SAN JUAN COUNTY Y  CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection witht the Properties CRECin connection with the Properties CRECin connection with the Properties  MRDS  MINE Mineral Resource MONTEZUMA SAN JUAN COUNTY Y  Dep ID: Considereda 10018648  Data System NO.1ANDI PLAIN SILVERTONCO  STREAK  81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTONCO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433  MRDS  MINE Mineral Resource MAGNOLIA SAN JUAN COUNTY Y  Dep ID: Considereda 10018507  Data System  MRDS  MINE Mineral Resource NATALIE SAN. JUAN COUNTY Y  Depl ID: Considereda 10016737  Data System  MRDS  MINE Mineral Resource SILVER LEDGE SAN JUAN COUNTY Y  Dep ID: Considereda 10108454  Data System  MRDS  MINE Mineral Resource ROSS BASIN SAN JUAN COUNTY Y  Dep ID: Considereda 10289028  Data System  MRDS  MINE Mineral Resource MASTODON SAN JUAN COUNTY Y  Dep ID: Considered. a 10018673  Data System Data System  MRDS  MINE Mineral Resource MASTODON SAN. JUAN COUNTY Y  Dep ID: Considereda 10118758  MRDS  MINE Mineral Resource UNKNOWN SAN. JUAN COUNTY Y  Dep ID: Considered: a 10240592  Data System  GROUP  MRDS  MINE Mineral Resource SILVER QUEEN SAN. JUAN COUNTY Y  Dep ID: Considereda 10018675  Data System  MRDS  MINE Mineral Resource GOLDI PRINCE, SAN. JUAN COUNTY Y  Dep ID: Considereda 10009757  Data System  MASTEDON  MRDS  MINE Mineral Resource SILVER QUEEN SAN JUAN COUNTY Y  Dep ID: Considereda 10107900  Data System  MINE  July 2024  15  SHE Environmental Consulting, LLC    Database MRDS  ASTM Type  Name Data System  Company Site Name  Address SILVERTON CO 81433 SAN JUAN COUNTY Y SILVERTON CO 81433  On Facility Status Comments Depl ID: Considereda 10281398  Site  MINE Mineral Resource GOLDI PRINCE SAN JUAN COUNTY Y  CRECin connection with the Properties CRECin connection witht the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties  MRDS  MINE Mineral Resource  LEAD  Dep ID: Considereda 10240085  Data System CARBONATE  MRDS  MINE Mineral Resource SILVER QUEEN SAN. JUAN COUNTY Y  Dep ID: Considereda 10142879  Data System LEADZINCGR SILVERTON CO  81433 SILVERTON CO 81433 SAN. JUAN COUNTY Y SILVERTONCO 81433 SAN. JUAN COUNTY Y SILVERTON CO 81433 SILVERTONCO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433  MRDS  MINE Mineral Resource PRIDE OF SAN. JUAN COUNTY Y  Dep ID: Considereda 10107846  Data System  BONITA EAGLE MOUNTAIN ROSE  MRDS  MINE Mineral Resource  Dep ID: Considered: a 10009762  Data System  MRDS  MINE Mineral Resource  Dep ID: Considereda 10108299  Data System  MRDS  MINE Mineral Resource GOLDI KING SAN. JUAN COUNTY Y  Dep ID: Considereda 10167198  Data System  MRDS  MINE Mineral Resource GOLDKING SANJ JUAN COUNTY Y  Dep ID: Considered: a 10215736  Data System  MRDS  MINE Mineral Resource SILVER WING SAN. JUAN COUNTY Y  Dep ID: Considereda 10018649  Data System  PROPERTY  MRDS  MINE Mineral Resource RANSOME LODE SAN JUAN COUNTY Y  Dep ID: Considered a 10009487  Data System  MRDS  MINE Mineral Resource INDEPENDENCE SAN. JUAN COUNTY Y  Dep ID: Considered: a 10264760  Data System  MRDS  MINE Mineral Resource ADELPHIN SAN JUAN COUNTY Y  Dep ID: Considered: a 10167141  Data System  July 2024  16  SHE EvionmenaConuEn, LLC    Database ASTM1 Type MRDS  Name Data System  Company! Site Name DEMOCRAT  Address SAN. JUAN COUNTY Y SILVERTON CO 81433 SILVERTON CO 81433 SILVERTONCO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTONCO 81433 SILVERTONCO 81433 SILVERTON CO 81433  On Facility Status Comments Dep ID: Considereda 10018556  Site  MINE Mineral Resource SOUND  CRECin connection witht the Properties CRECin connection with the Properties CRECin connection withthe Properties CRECin connection witht the Properties CRECin connection witht the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties  MRDS  MINE Mineral Resource SOUND SAN JUAN COUNTY Y  Dep ID: Considereda 10143010  Data System  DEMOCRAT  MRDS  MINE Mineral Resource GLADSTONE SAN. JUAN COUNTY Y  Dep ID: Considereda 10142997  Data System  MRDS  MINE Mineral Resource PLAINSTREAK SAN JUAN COUNTY Y  Dep ID: Considereda 10191688  Data System  MRDS  MINE Mineral Resource REDAND SAN JUAN COUNTY Y  Dep ID: Considereda 10018669  Data System  BONITA  MRDS  MINE Mineral Resource BISMARCK SANJ JUAN COUNTY Y  Dep ID: Considereda 10018668  Data System  MRDS  MINE Mineral Resource SILVER LEDGE SANJ JUAN COUNTY Y  Dep ID: Considereda 10119122  Data System  MRDS  MINE Mineral Resource MONTEZUMA#1 SANJ JUAN COUNTY Y  Depl ID: Considereda 10143533  Data System  MRDS  MINE Mineral Resource SILVER QUEEN SAN. JUAN COUNTY Y  Dep ID: Considereda 10108298  Data System  LEADZINC GROUP  MRDS  MINE Mineral Resource UNKNOWN SAN. JUAN COUNTY Y  Dep ID: Considereda 10215720  Data System  MRDS  MINE Mineral Resource RED & BONITA SAN. JUAN COUNTY Y  Depl ID: Considereda 10264483  Data System  MRDS  MINE Mineral Resource BIG COLORADO SAN. JUAN_COUNTY Y  Dep ID: Considereda 10240500  Data System  July 2024  17  SH Environmental Consulting, LLC    Database ASTMType MRDS  Name Data System  Company Site Name  Address SAN JUAN COUNTY Y SILVERTON CO 81433 SILVERTON CO 81433 SILVERTONCO 81433 SILVERTON CO 81433 SILVERTONCO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTONCO 81433 SILVERTON CO 81433 SILVERTON CO 81433  On Facility Status Comments Depl ID: Considereda 10108455  Site  MINE Mineral Resource ADAMS  CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection witht the Properties CRECin connection with the Properties CRECin connection witht the Properties CRECin connection with the Properties  MRDS  MINE Mineral Resource EARLY BIRD SAN. JUAN COUNTY Y  Depl ID: Considereda 10017829  Data System  MRDS  MINE Mineral Resource ADAMS LODE- SAN. JUAN COUNTY Y  Depl ID: Considereda 10119011  Data System  BISMARK  MRDS  MINE Mineral Resource UNKNOWN SANJ JUAN COUNTY Y  Depl ID: Considereda 10216117  Data System  GROUP  MRDS  MINE Mineral Resource MOUNTAIN SAN. JUAN COUNTY Y  Depl ID: Considereda 10119275  Data System  QUEEN  MRDS  MINE Mineral Resource STANDARDI MILL SAN. JUAN COUNTY Y  Depl ID: Considereda 10240259  Data System  MRDS  MINE Mineral Resource AMERICAN SAN. JUAN COUNTY Y  Dep ID: Considereda 10265079  Data System  TUNNEL  MRDS  MINE Mineral Resource PRIDEC OF SAN. JUAN COUNTY Y  Dep ID: Considereda 10143474  Data System  BONITA  MRDS  MINE Mineral Resource UNKNOWN SAN. JUAN COUNTY Y  Dep ID: Considereda 10118706  Data System  MRDS  MINE Mineral Resource GOLDI KINGI MILL SAN JUAN COUNTY Y  Dep ID: Considereda 10018664  Data System  PLACER  MRDS  MINE Mineral Resource PITTSBURGH SAN. JUAN COUNTY Y  Depl ID: Considereda 10191550  Data System  MRDS  MINE Mineral Resource BIG COLORADO SAN JUAN COUNTY Y  Depl ID: Considereda 10018659  Data System  July 2024  18  SH EnvronmenaiComunns. LLC    Database MRDS  ASTM Type  Name Data System  Company! Site Name  Address SILVERTON CO 81433 SAN. JUAN COUNTY Y SILVERTONCO 81433 SANJ JUAN COUNTY Y SILVERTONCO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SAN. JUAN COUNTY Y SILVERTONCO 81433 SILVERTON CO 81433  On Facility Status Comments Dep ID: Considereda 10018660  Site  MINE Mineral Resource GOLD THREAD SAN. JUAN COUNTY Y  CRECin connection witht the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection witht the Properties CRECin connection witht the Properties CRECin connection with the Properties CRECin connection with the Properties  MRDS  MINE Mineral Resource  BLACK DIAMOND  Dep ID: Considereda 10017770  Data System  MRDS  MINE Mineral Resource EZRAR  Dep ID: Considereda 10119212  Data System  MRDS  MINE Mineral Resource GOLDKING SAN. JUAN COUNTY Y  Dep ID: Considereda 10017775  Data System  MRDS  MINE Mineral Resource MOGUL SAN JUAN COUNTY Y  Dep ID: Considereda 10118864  Data System  MRDS  MINE Mineral Resource EVENING STAR SAN JUAN COUNTY Y  Depl ID: Considereda 10167415  Data System  MRDS  MINE Mineral Resource EVENING STAR SAN JUAN COUNTY Y  Dep ID: Considereda 10017769  Data System  MRDS  MINE Mineral Resource QUEEN ANNE SAN JUAN COUNTY Y  Depl ID: Considered. a 10017771  Data System  MRDS  MINE Mineral Resource COLUMBIA SAN. JUAN COUNTY Y  Dep ID: Considereda 10017776  Data System  MRDS  MINE Mineral Resource COLUMBIA SAN JUAN COUNTY Y  Dep ID: Considereda 10264880  Data System  MRDS  MINE Mineral Resource CUSTER  Dep ID: Considered: a 10289358  Data System  MRDS  MINE Mineral Resource CUSTER SAN JUAN COUNTY Y  Dep ID: Considereda 10017768  Data System  July 2024  19  SH Environmental Consulting, LLC    Database ASTMT Type MRDS  Name Data System  Company! Site Name  Address SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTONCO 81433 SAN. JUAN COUNTY Y 81433 SILVERTON CO 81433 SILVERTON CO 81433 SAN JUAN COUNTY Y SILVERTON CO 81433 SAN JUAN COUNTY Y SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433  On Facility Status Comments Depl ID: Considereda 10142939  Site  MINE Mineral Resource QUEEN ANNE SAN JUAN COUNTY Y  CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection witht the Properties  MRDS  MINE Mineral Resource INDIAN CHIEF SAN JUAN COUNTY Y  Dep ID: Considereda 10119458  Data System  MRDS  MINE Mineral Resource UNKNOWN SAN. JUAN COUNTY Y  Depl ID: Considereda 10119404  Data System  MRDS  MINE Mineral Resource UNKNOWN SAN JUAN COUNTY Y  Dep ID: Considereda 10158833  Data System  MRDS  MINE Mineral Resource COMO  Depl ID: Considereda 10191907  Data System CONSOLIDATED SILVERTON CO  MRDS  MINE Mineral Resource ENDLESS CHAIN SAN. JUAN COUNTY Y  Depl ID: Considereda 10167378  Data System  MRDS  MINE Mineral Resource AUBURN GROUP SANJ JUAN COUNTY Y  Depl ID: Considereda a 10167186  Data System  MRDS  MINE Mineral Resource  ROLLO  Dep ID: Considereda 10216484  Data System  MRDS  MINE Mineral Resource ROLLO  Dep ID: Considered: a 10091010  Data System  MRDS  MINE Mineral Resource UNKNOWN SAN. JUAN COUNTY Y  Dep ID: Considereda 10191938  Data System  MRDS  MINE Mineral Resource DAKOTA SAN JUAN COUNTY Y  Dep ID: Considered: a 10018599  Data System  MRDS  MINE Mineral Resource SILVER CHORD SAN JUAN COUNTY Y  Depl ID: Considereda 10240212  Data System  July 2024  20  SH Environmental Consulting. LLC    Database ASTM Type MRDS  Name Data System  Company! Site Name  Address SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTONCO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTONCO 81433 SILVERTON CO 81433  On Facility Status Comments Dep ID: Considereda 10018641  Site  MINE Mineral Resource BELCHER SAN JUAN COUNTY Y  CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection witht the Properties CRECin connection witht the Properties  MRDS  MINE Mineral Resource BELCHER TUN SAN JUAN COUNTY Y  Dep ID: Considereda 10191916  Data System  NO.1  MRDS  MINE Mineral Resource BONANZA SAN. JUAN COUNTY Y  Dep ID: Considereda 10240027  Data System  MRDS  MINE Mineral Resource BONANZA SAN JUAN COUNTY Y  Dep ID: Considereda 10016736  Data System  MRDS  MINE Mineral Resource UNKNOWN SANJ JUAN COUNTY Y  Dep ID: Considereda 10215850  Data System  MRDS  MINE Mineral Resource SEVEN-THIRTY SAN JUAN COUNTY Y  Dep ID: Considereda 10017789  Data System  MRDS  MINE Mineral Resource RED ROGERS SAN. JUAN COUNTY Y  Dep ID: Considereda 10143492  Data System Data System  MRDS  MINE Mineral Resource REDI ROGERS SAN JUAN COUNTY Y  Dep ID: Considereda 10017774  MRDS  MINE Mineral Resource UNKNOWN SAN. JUAN COUNTY Y  Dep ID: Considereda 10264862  Data System  MRDS  MINE Mineral Resource SILVER CLOUD SAN. JUAN COUNTY Y  Dep ID: Considereda 10018642  Data System  MRDS  MINE Mineral Resource HESPERIAN SAN. JUAN COUNTY Y  Dep ID: Considereda 10216263  Data System  MRDS  MINE Mineral Resource SERRANO SAN JUAN COUNTY Y  Depl ID: Considereda 10143330  Data System  July 2024  21  SHE Environmental Consulting, LLC    Database ASTM" Type MRDS  Name Data System  Company! Site Name  Address SAN JUAN COUNTY Y SILVERTONCO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTONCO 81433 SILVERTONCO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SAN. JUAN COUNTY Y SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433  On Facility Status Comments Dep ID: Considereda 10118789  Site  MINE Mineral Resource PICKET  CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection witht the Properties CRECin connection witht the Properties  MRDS  MINE Mineral Resource UNKNOWN SAN. JUAN COUNTY Y  Dep ID: Considereda 10216002  Data System  GROUP  MRDS  MINE Mineral Resource BURROWS SAN JUAN COUNTY Y  Dep ID: Considereda 10018643  Data System  MRDS  MINE Mineral Resource EVENING STAR SANJ JUAN COUNTY Y  Depl ID: Considereda 10167581  Data System  MRDS  MINE Mineral Resource LITTLE IDA SAN JUAN COUNTY Y  Depl ID: Considereda 10119036  Data System  MRDS  MINE Mineral Resource CALEDONIAN SAN JUAN COUNTY Y  Dep ID: Considereda 10017777  Data System  MRDS  MINE Mineral Resource ACAPULCA SAN. JUAN COUNTY Y  Dep ID: Considereda 10167815  Data System Data System  MRDS  MINE Mineral Resource ACAPULCA SAN. JUAN COUNTY Y  Dep ID: Considered: a 10018637  MRDS  MINE Mineral Resource ALASKA  Dep ID: Considereda 10108449  Data System  MRDS  MINE Mineral Resource VALLEY FORGE SAN JUAN COUNTY Y  Dep ID: Considered. a 10288746  Data System  MINE  MRDS  MINE Mineral Resource OCCIDENT TUN SAN JUAN COUNTY Y  Dep ID: Considereda 10192209  Data System  MRDS  MINE Mineral Resourcel STARC OFT THE SAN JUAN COUNTY Y  Dep ID: Considereda a 10264573  Data System  WEST  July 2024  22  SH Environmental Consulting, LLC    Database ASTM Type MRDS  Name Data System  Company Site Name  Address SILVERTON CO 81433 SILVERTON CO 81433 SAN JUAN COUNTY Y SILVERTON CO 81433 SAN JUAN COUNTY Y SILVERTON CO 81433 SILVERTON CO 81433 SILVERTON CO 81433 SILVERTONCO 81433 SILVERTON CO 81433 SILVERTONCO 81433 SILVERTONCO 81433 SILVERTONCO 81433 SAN. JUAN COUNTY Y SILVERTON CO 81433  On Facility Status Comments Dep ID: Considereda 10192286  Site  MINE Mineral Resource UNKNOWN SANJ JUAN COUNTY Y  CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection witht the Properties CRECin connection witht the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties  MRDS  MINE Mineral Resource UNKNOWN SAN JUAN COUNTY Y  Dep ID: Considereda 10191931  Data System  MRDS  MINE Mineral Resource ALASKA  Dep ID: Considereda 10288721  Data System  MRDS  MINE Mineral Resource  SAXON  Dep ID: Considered: a 10018639  Data System  MRDS  MINE Mineral Resource MAXWELL SAN. JUAN COUNTY Y  Dep ID: Considereda 10118765  Data System  MRDS  MINE Mineral Resource UNKNOWN SAN. JUAN COUNTY Y  Dep ID: Considereda 10288905  Data System  MRDS  MINE Mineral Resource UNKNOWN SAN. JUAN COUNTY Y  Dep ID: Considereda 10143041  Data System  MRDS  MINE Mineral Resource MAYFLOWER SAN. JUAN COUNTY Y  Depl ID: Considereda 10288826  Data System  MILL  MRDS  MINE Mineral Resource UNKNOWN SAN. JUAN COUNTY Y  Dep ID: Considereda 10289254  Data System  MRDS  MINE Mineral Resource VALLEY FORGE SAN. JUAN COUNTY Y  Dep ID: Considereda 10018502  Data System  GROUP  MRDS  MINE Mineral Resource ASPENMINE SANJ JUAN COUNTY Y  Dep ID: Considereda 10215928  Data System  MRDS  MINE Mineral Resource ASPEN  Dep ID: Considereda 10108415  Data System  July 2024  23  SH Environmental Consulting, LLC    Database ASTM Type MRDS  Name Data System  Company Site Name  Address SILVERTONCO 81433 SILVERTONCO 81433 SILVERTONCO 81433 SILVERTON CO 81433  On Facility Status Comments Depl ID: Considereda 10240506  Site  MINE Mineral Resource UNKNOWN SAN. JUAN COUNTY Y  CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties CRECin connection with the Properties Not RECin connection with the Properties Not RECin connection with the Properties Not RECin connection with the Properties  MRDS  MINE Mineral Resource UNKNOWN SANJ JUAN COUNTY Y  Dep ID: Considereda 10281162  Data System  MRDS  MINE Mineral Resource LACKAWANNA SAN. JUAN COUNTY Y  Dep ID: Considereda 10108414  Data System  MINE  MRDS  MINE Mineral Resource LACKAWANNA SAN. JUAN COUNTY Y  Depl ID: Considereda 10118703  Data System  MINE  MRDS  MINE Mineral Resource SILVERTON SAN. JUAN COUNTY Y  Dep ID: Considered: a 10018500  Data System RESERVOIR BOG SILVERTON CO  IRON DEPOSIT DORA  81433 SAN. JUAN COUNTY Y SILVERTONCO 81433 SILVERTON CO 81433  MRDS  MINE Mineral Resource  Dep ID: Considereda 10143211  Data System  MRDS  MINE Mineral Resource LITTLE DORA SAN JUAN COUNTY Y  Dep ID: Considered: a 10018497  Data System  MRDS  MINE Mineral Resource CORNING SAN. JUAN COUNTY Y  Dep ID: Considered: a 10108413  Data System WONDER MINE SILVERTON CO  81433  SMCRA  MINE  Surface Mining OURAY COUNTY Ouray County CO N AMLIS Key:  Control and Reclamation Act Sites Data System  COAL-CO- WIDE  CO004698 considereda  MRDS  MINE Mineral Resource UNKNOWN OURAY COUNTY N  Dep ID: 10143374 considereda  OURAY CO8 81427  MRDS  MINE Mineral Resource VERNON MINE OURAY COUNTY N  Dep ID: 10215673 considereda  Data System  OURAY CO81427  July 2024  24  SH Environmental Consulting, LLC    Database MRDS  ASTM Type  Name Data System  Company! Site Name  Address OURAY COUNTY N OURAY CO 81427  On Facility Status Comments Dep ID: 10287962 considereda  Site  MINE Mineral Resource UNKNOWN  Not RECin connection with the Properties Not RECin connection with the Properties Not RECin connection with the Properties Not RECin connection witht the Properties connection with the Properties connection with the Properties Not RECin connection witht the Properties Considereda CRECin connection witht the Properties Considereda CRECin connection witht the Properties Not considereda RECin connection witht the Properties Not considereda RECin connection with the Properties  MRDS  MINE Mineral Resource UNKNOWN OURAY COUNTY N  Dep ID: 10118530 considereda  Data System  OURAY CO81427  MRDS  MINE Mineral Resource UNKNOWN OURAY COUNTY N  Depl ID: 10143073 considereda  Data System  OURAY CO 81427  SEMS  NPL  SEMS List 8R Inventory  REDAND COUNTY ROAD! 52 N  EPAID: CON000802811 considereda  Active Site BONITA MINE SILVERTONCO  81433  NPL  NPL  National Priority BONITA PEAK Multiple sources Y  EPAI ID: Considered a CON000802497 CRECin EPAID: Considered: a CON000802497 CRECin EPAI ID: CON000802803 considereda  List  MINING DISTRICT MINING DISTRICT  near Animas River headwaters UNINCORPORATED CO81433 near Animas River headwaters UNINCORPORATED CO81433 CEMENT 11400F FTELEVATION) SILVERTON CO 81433 near Animas River headwaters UNINCORPORATED CO8143 CO  SEMS  NPL  SEMS List 8R BONITA PEAK Multiple sources Y  Active: Site Inventory  SEMS  NPL  SEMS List 8R MOGUL/GRAND Active! Site MOGUL MINE(S) CREEKAPPROX Inventory Superfund Decision Documents Superfund National Mining District/ Priorities List and Natural Resource Damages sites Superfund IDARADOMINE National Priorities List and Natural Resource Damages sites Sectors  N  SUPERFUND ROD  NPL  BONITA PEAK Multiple sources Y  MINING DISTRICT Bonita Peak BPM  SUPERFUND NPLEQUIV NRD  Y  SUPERFUND NPLEQUIV NRD  CO  N  PFASIND  PFAS  PFASI Industry ALTA GOLD CO SILVERTONCO N  (SUNNYSIDE MINE)  July 2024  25  SHE Environmental Consulting, LLC    Database ASTM Type PFASIND  Name PFASI Industry SUNNYSIDE Sectors  Company Site Name GOLD CORP MAYFLOWER  Address SILVERTON CO N  On Facility! Status Comments  Site  PFAS  Not considereda RECin connection witht the Properties RECin connection witht the Properties connection witht the Properties Considereda CRECin connection witht the Properties Not considereda RECin connection with the Properties  RCRAI NONGEN RCRAGEN  RCRAI Non- ALTA GOLD CO 7MINONHWY110, N EPAI Handler ID: Not  Generators  (SUNNYSIDE MINE)  SILVERTON CO 81433  COD000716662 considereda  FINDS/FRS  SITE  Facility Registry BONITAR PEAK MULTIPLE: SOURCES Y Registry ID: Considereda  Service/Facility Index Solid Waste Facilities and SILVERTON Landfills Facilities and Landfills  MINING CLOSED  NEAR ANIMAS UNINCORPORATED CO81433 APPROXIMATEIY1 Y MILEE EAST OF CO81520  110070058573 CRECin  DISTRICT RIVER HEADWATERS  SWF/LF  SWFLF  LANDFILL TOWN SILVERTON  SWF/LF  SWFLF  Solid Waste NEW SILVERTON Silverton CO 81433 N  TRANSFER STATION  4.2 Historical Resources Reviewed  Historical sources were obtained from ERIS, including oil and gas wells (Physical Settings Report Appendix E), agency. records (Database Report Appendix G), aerial photographs (Aerial Photographs - Appendix H), topographic maps (Historical Topographic Maps Appendix 1), for the Properties and vicinity. Copies of these  historical sources are provided in the identified appendices.  Historical Resource Aerial Photographs Historical Topographic Maps Colorado Division of Oil and Public Safety US Environmental Protection Agency  Years Reviewed  1945, 1951, 1960, 1972, 1975, 1986, 1998, 2005, 2009, 2011, 2013, 2015, 2017, 2019, 2021, 2023 1897, 1901, 1902, 1955, 1972, 1975, 2001, 2013, 2016,  2019 Up to. June 2024 Up to. June 2024  Colorado Department of Public Health and Environment Up to. June 2024  July 2024  26  SH Environmental Consulting, LLC    4.3 Historical Use Information on the Subject Property  Historical Summary Table  Dates 1897  Issue Identified? No  Uses  Source(s)  Mines and building structures are present. Early Topographic Maps  roadways and railroad tracks extending east along the Animas River from Silverton to Arrastre Creek are visible. Eureka townsite is present. Mines, building structures, and roadways are present. The Silverton and Northern Railroad tracks extend past Arrastre Creek to the Eureka Townsite. Mines, building structures, and roadways are are gone. The Eureka townsite is gone. The Mayflower Mill tailings ponds are present. Mines and roadways are present and the road 2.crossing the southern Properties is further Significant development of the Mayflower Mill mine symbols are illustrated on the topographic  1901,1902 1945,1951, 1955 1960,1972, 1975 1986, 1998 2001,2003, 2005,2009, 2011,2013, 2015,2016, 2017,2019, 2021,2022, 2024  No No  Topographic Maps Aerial Photographs  present. The Silverton and Northern Railroad tracks Topographic Maps  No  Aerial Photographs  along Animas Riveri is visible. San. Juan County Road Topographicl Maps  developed.  No No  Aerial Photographs Topographic Maps  tailing ponds. Fewer mining claims are apparent. Topographic Maps The Properties appear relatively unchanged. Fewer Aerial Photographs maps. Mining activities appear to be nonexistent. On-site Observations  4.4 Historical Use Information on Adjacent Properties Historical Summary North Adjacent Property  Dates 1897,1901, 1902 1945,1951, 1955,1960, 1972,1975 1986, 1998 2013,2015, 2016,2017, 2019,2021, 2022, 2024  Issue Identified? No No No No  Uses visible.  Source(s) Topographic Maps Aerial Photographs Topographicl Maps Aerial Photographs TopographicMaps Aerial Photographs Onsite Observations  Sunnyside Mine and Sunnyside Mill are present. Few mines, building structures, and roadways are  Increased mining activity. Mining activity appears stagnant. Mining activities appear to be nonexistent. Eureka Campground is present in thet former  Properties are undeveloped mountain terrain. The Topographic Maps  townsite.  July 2024  27  SH Environmental Consulting, LLC    Historical East Adjacent Property  Dates 1987,1901, 1902 1945,1951, 1955, 1960, 1972,1975 1986,1998 2013,2015, 2016,2017, 2019,2021, 2022,2024  Issue Identified? No  Uses  Source(s) Topographic Maps  Few mines and building structures are present. Early roadways and the Eureka townsite is visible. Midway Mill located approximately one-mile east of Eureka is present. Increased mining activity. Eurekai townsite and Midway Mill are gone. Mining activity appears stagnant. Mining activities appear to ber nonexistent. Eureka Campground is present in thei former townsite. Mining activity is nonexistent.  No No No  Aerial Photographs Topographic Maps Aerial Photographs Topographic Maps Aerial Photographs Onsite Observations  Properties are undeveloped mountain terrain. The Topographic Maps  Historical: South Adjacent Property  Dates 1897,1901, 1902 1945,1951 1955 1960, 1972, 1975, 1986, 1998,2013, 2015,2016, 2017,2019, 2021,2022, 2024  Issue Identified? No  Uses  Source(s) Topographic Maps  Few mines and building structures are present. Early roadways and railroad tracks extending east along the Animas River from Silverton to Arrastre Little mining activity and development. An airstrip and a powerplant are present above and to the east of the town of Silverton. and the area remains relatively unchanged as undeveloped mountainous terrain.  Creek are visible.  No No No  Aerial Photographs Topographic Maps Aerial Photographs Topographic Maps Topographic Maps Onsite Observations  Little to no development occurred during this time Aerial Photographs  Historical West Adjacent Property  Dates 1897,1901, 1902 1945,1951, 1955,1960, 1972,1975 1986, 1998  Issue Identified? No No No  Uses  Source(s) Topographic Maps Aerial Photographs Topographic Maps Aerial Photographs Topographic Maps  Town of Silverton, at few mines and building structures are present. Early roadways are apparent. Increased mining activity.  Mining activity appears stagnant and the area remains relatively unchanged.  July 2024  28  SH Environmental Consulting, LLC    Dates 2013,2015, 2016,2017, 2019,2021, 2022,2024  Issue Identified? No  Uses  Source(s) Aerial Photographs Topographic Maps Onsite Observations  Mining activities appear to be nonexistent. Properties are undeveloped mountain terrain,  4.5 Data Gaps/Data Failure  Based on the definition presented in ASTM E2247-16, data failure occurs when all the standard historical sources that are easonablyascerainabe and likely to be useful have been reviewed and the historical use of the Property has not been documented back to the Property's first developed use, or 1940, whichever is earlier. When data failure occurs, ASTM E2247-16 requires the Environmental Professional to document the data failure and assess the potential impact on the ability of the Environmental Professional to identify RECS. SH Environmental Consulting obtained historical use data of the Properties in accordance with ASTM No data gaps occurred during the performance of this ESA. This ESA was completed in accordance with  E2247-16and therefore no related data failure was identified.  ASTME E2247-16.  5.0 SITERECONNASSANCE  Issue  Subject Property No No No No No No No No No No Yes No No No No No Yes  Adjacent Properties No No No No No No No No No No Yes No No No No Yes Yes  Hazardous Substances and Petroleum Products Underground. Storage Tanks Aboveground Storage Tanks Odors Pools of Liquid Unidentified Substances Drums On-Site Chemicals Hydraulic Oil  Polychlorinated Biphenyl's (PCBs) Pits, Ponds, or Lagoons Stained Soil or Pavement Stains or Corrosion Stressed Vegetation Soil Waste Transformers Wastewater July 2024  29  SH Environmental Consulting, LLC    Issue Wells Septic System Drains and Sumps  Subject Property Yes No No  Adjacent Properties Yes No No  Steve Hoffman, P.G. and Shelly Hoover, P.E. conducted the site reconnaissance from June 10 - 12, 2024, to assess for the possible presence of petroleum products and hazardous materials at the Properties. Prior to performing the field inspections, personnel met with Mr. William Tookey, County Administrator for San Juan County to discuss aspects of the Properties. The weather at the time of site reconnaissance was clear and approximately 70 degrees Fahrenheit. Photographs from the site reconnaissance are provided in AppendixJ. Many of the properties included in this ESA were inspected in October 2022 during the Phase I ESA conducted by Iron Woman Construction and Environmental Services. This inspection included several properties that were not accessible during the current ESA. Photographic documentation from the 2022s site Personnel drove, walked, and observed the Properties and the surrounding properties. Many of the Properties were discovery diggings where, in order to establish a mining claim, the property was developed with shallow digging. Other Properties that had been mined for ore appeared to be remediated by relocation and stabilization of the mine tailings. Engineered water collection and settlement ponds were constructed in areas where mine water was discharging. There are areas of scattered debris from former mining and historical development activities. Remnants are present on Parcel 47750140050002 of the former boiler house used in the operation of the tramway, wood and metal debris, concrete tramway foundation, and a powder magazine cut into the mountain side that was used for the storage of explosives during active mining. Due to the inaccessibility of some of the parcels, physical inspections were not possible. However, these parcels were observed for meaningful mine workings using telescopic visualizations.  reconnaissance is included in AppendixJ.  6.0 INTERVIEWS 2024.  Interviews conducted in 2022 are reproduced below, along with follow-up interviews in June 2024 and July  Title  Name Dennis McHarness  Comments  Vice President, Kinross Gold USA-Owner/ Occupant  October 6, 2022: SGC operated the Sunnyside Mine and Properties of this ESA from 1985 to 1991 and acquired ownership in 1992. All mining operations ceased in 1991. SGC entered into a Consent Decree with the CWQCDi in 1996 and the EPA in August 2015. Since this time, remedial investigations and corrective actions have been completed. SGC was released from environmental responsibility by the EPA in April 2022. Mr. McHarness provided Acreage Reduction Approval letters issued byt the Colorado Division of Minerals and Geology, Permit to Discharge termination letters issued byt the CDPHE, and Financial and Performance Warranty Release Approvals issued by the Colorado Division of Mining and Safety. These documents are provided in July 3, 2024: Mr. McHarness said that there have not been any new documents or changes to the status of the SGC claims since being last interviewed in October 2022.  Appendix K.  July 2024  30  SH Environmental Consulting, LLC    Title  Name  Comments  San. Juan County Liaison- Anthony Edwards  October 21, 2022: Mr. Edwards has been the liaison for San Juan County since August 2015. Hei is familiar with legal and environmental issues associated with the BPMD. Mr. Edwards completed the User Questionnaire June 12, 2024: Mr. Edwards was not aware of any changes occurring in connection with the Properties since being last interviewed in October 2022. October 13, 26, 2022: The SGC mining parcels have been investigated and remediated to the satisfaction of the EPA. The SGC portals and adits have been closed or safety secured in accordance with the Colorado Division ofF Reclamation, Mining and Safety regulations. Active and pending remediation is on-going at the Terry Tunnel and the Mayflower Mill tailings ponds. The EPA and CDPHE are working on a remedial investigation and feasibility study for management of the groundwater. Activity on these area willl be on-going for over 10 years. SGC was release of environmental liability in 2022 on Hel has not observed fuel storage tanks or other potential hazardous conditions ont the SGC Properties. June 5, 2024: No changes have occurred toi the Properties since the lasti interview in October 2022.  User  on behalf of San. Juan County.  Colorado Depatment of Mark Rudolph  Public Health and Environment  these Properties.  7.0 EVALUATION County, Colorado.  SH Environmental Consulting has performed this Phase IESA in conformance with the scope and limitations of ASTM Standard Practice E2247-16 of the mining claim properties owned by SGC and located in San Juan Based on aerial photographs, topographic maps, regulatory agency records, the San Juan County Assessor, personal interviews, and onsite observations, this Phase I ESA revealed that the Properties are located entirely in an EPA Superfund designated area. Mining began in San Juan County in the 1870s and ended in 1991, when the last producing mine ceased production. These accumulated mining activities resulted in contamination of heavy metals and sediments that impacted the soil, groundwater, and surface water over three drainages in the watershed. Over 400 abandoned or inactive mines are present in these three drainages. Due to this contamination, the EPA listed the area as the Bonita Peak Mining District Superfund Environmental investigations and remedial actions have been performed by SGC and the EPA to reduce or eliminate loading to the waterways by metals from mine disturbance sediments. Based upon the San Juan County Assessor's Property and Map Search website on October 20, 2022, and May 24, 2024, and interviews with the CDPHE, the SGC Properties have been remediated to the extent required by the regulations of the Bonita Peak Mining District Superfund. While these Properties have been remediated to the extent required by regulation for the Superfund listing, the Properties have not been remediated for unrestricted use. This Phase I ESA did not reveal evidence of RECs in connection with the Properties. Water drainage from Terry Tunnel, the Mayflower Mill Tailing ponds, and groundwater impacted with metals are environmental  site and addedi it to the National Priorities List on September 9, 2016.  Therefore, the Superfund listing is considered a CREC in connection with the Properties. concerns in connection with the Properties that are being addressed by the EPA.  July 2024  31  SHE Environmental Consulting, LLC    This Phase I ESA did not reveal evidence of HRECS in connection with the Properties. While regulatory closures were issued on the Properties, these closures are based upon the Superfund regulatory According to ASTM E2600-15 and based upon the absence of known or reported hazardous chemicals or volatile organic compounds released to the Properties or immediate surrounding area, a vapor  requirements and not for unrestricted use. encroachment condition can be ruled out.  8.0 ENVIRONMENTAL PROFESSIONALS STATEMENT  Ideclare that, to the best of my professional knowledge and belief, I meet the definition of Environmental Professional as defined in $312.10 of 40CFR Part 312.Ihave the specific qualifications based on education, training, and experience to assess a property. I have developed and performed all appropriate inquiries in conformance with the standards and practices set forth in 40 CFR Part 312. Qualifications for the  Environmental Professional are included in Appendix L.  H  Steven B. Hoffman, P.G. Environmental Professional  July 2024  32  SH Environmental Consulting, LLC    9.0 REFERENCES E2247-16.  American Society for Testing and Materials (ASTM), Standard Practice for Environmental Site Assessments: Phase I Environmental Site Assessment Process for Forestland or Rural Property, ASTM Designation: ASTM, Standard Guide for Vapor Encroachment Screening on Property Involved in Real Estate Transactions, Aerial Photographs: 1945, 1951, 1960, 1972, 1975, 1986, 1998, 2005, 2009, 2011, 2013, 2015, 2017,2019, Colorado Department of Public Health and Environment: Online records review, June 18, 2024. Colorado Division of Water Resources: Online well permit search, June 18, 2024.  ASTM Designation: E2600-15.  2021, 2023.  Colorado Department of Labor and Employment-Dwvision of Oil and Public Safety: Online records search, ERIS, 2520 South Interstate Highway 35, Suite 200 Austin, Texas, (512)823-0217: Database Report dated, ERIS, 2520 South Interstate Highway 35, Suite 200 Austin, Texas, (512) 823-0217: Physical Settings Maps, Oil  June 18, 2024. May 28, 2024.  and Gas Report, Water Well Report, May 24, 2024.  Iron' Woman Construction and Environmental Services, Phase IESA, December 20, 2022. San Juan County Board of Commissioners: Ordinance No. 2020-01, December 15, 2020. San Juan County Assessors: Property and Map Search, October 2022.  United States District Court for the District of New Mexico: Consent Decree, August 5, 2015. United States District Court for the District of New Mexico: Consent Decree, April 29, 2022. I Unilateral Administrative Order for Remedial Investigation, March 15, 2010. Interim Record of Decision, Bonita Peak Mining District Superfund Operable Unit 1, May 20, 2019. Adaptive Management Site Management Plan for the Bonita Peak Mining District, November 2020. United States Geological Survey 7.5 & 15 Minute Series Topographic Maps; Silverton, CO 1897, 1901, 1902, 1955, 1972, 1975, 2001, 2013,2016, 2019. Handies Peak, CO, Ironton, CO, Howardsville, CO 1955, 1972, 1975,2001,2013, 2016, 2019.  United States Environmental Protection Agency (EPA):  July 2024  33  SH Environmental Consulting, LLC    Appendix A, Figure 1  Site Location/Topographic Map    Area of Mining Claims (approx.)  Area of Mining Claims (approx.)  Not to Scale  Site location/Iopographic Map Sunnyside Gold Corporation Mining Claims San. Juan County, Colorado FIGURE No.1  SHI ENVIRONMENTAL CONSULTING ARVADA, COLORADO    Figure 2 Site Detail    pglar a nway  Silverton Mountain SKIA  OldHundred Gold MineTour  Silverton  Source dfROGrandeRGy  Not to Scale  SHENVIRONMENTALCONSULTING ARVADA, COLORADO  Site Detail Map Sunnyside Gold Corporation Mining Claims San Juan County, Colorado FIGURE No. 2  Subject Mine Claim    Figure 3 Parcel Map    5990 parcel 42750150050001 arceLA477501S parce 501500500  parcel  par1477 0190050004  parcel 47730190030006 parcei 47730190030005  PKTEN2SPIOXicaS  Not to Scale  Parcel Map Sunnyside Gold Corporation Mining Claims San. Juan County, Colorado FIGURE No. 3  SHENVIRONMENTAL CONSULTING ARVADA, COLORADO: 80004    Appendix B  Mining Claim Parcel List    Exhibit A  The Following Properties are Located in Township 42 North, Range 6' West, Township 42 North, Range 7 West, and' Township 41 North, Range 7 West, N.M.P.M.  Description/Claim Name and Mineral Survey No. EUREKA TOWNSITE LOTS ACCORDING TO THE RECORDED BOUNDARY ADJUSTMENT THEREOF FILED FOR RECORD SEPTEMBER 30, 2011 AS RECEPTION: #148168 EUREKA TOWNSITELOT 64 ACCORDINGTO THE RECORDED BOUNDARY ADIUSTMENTTHEREO: FILED: FOR RECORD SEPTEMBER 30, 2011 AS RECEPTION: #148168 CASHIER LODE- MS 134 (UND 9/10) INT IN 10.5. ACRES), CENTENNIAL- MS 16635, NASBY MS 2508, ROVING RANGER LODE- MS 151 A, TAGNER - MS 16804, WHITE STAR - MS 14368 EUREKA TOWNSITE! LOTIA ACCORDINGTO THEI RECORDED BOUNDARY ADJUSTMENT THEREOF FILEDI FOR RECORD SEPTEMBER: 30, 2011AS RECEPTION: #148168 EUREKATOWNSIIE LOT2 ACCORDINGTO THE RECORDED BOUNDARY ADJUSTMENT THEREOF FILED FOR RECORD SEPTEMBER: 30, 2011A AS RECEPTIONH148168 BUREKATOWNSITE LOT3 ACCORDING TO THE RECORDED BOUNDARY ADJUSTMENT THEREOF FILED FOR RECORD SEPTEMBER 30, 2011 #148168 EUREKATOWNSITE LOT44 ACCORDINGTO THE RECORDED BOUNDARY ADJUSTMENT THEREOF FILED FOR RECORD SEPTEMBER 30, 2011 #148168 CASHIER MS 442, ORIENTAL- -MS 566, PRIDE OF THE ALPS -MS 572 EMMA MS 2273, LULU CARROLL - MS 873, MOTHER GOOSE- MS 17234, MOULTRIE LODE-I MS 173, PAYMASTER- - MS 1301, PONY - MS 2336(UND 2/3 INT IN 8.10 ACRES) MIDNIGHT- MS 5616 TAGGART- MS 2338 (UND 1/31 INTI IN7.22 ACRES)  Property Tax Parcel ID  #47730190030005  #47730190030006  #47730190050004  #47730300020001  #47730300020002 #47730300020003 #47730300020004 47750090050001  #47750100050003 #47750100050031 #47750100050051  Page lof3    PALOS MS 18732, PALOS #1 - MS 18732, PALOS #2- - MS 18732, SUNNYSIDE #2-MS 20003, SUNNYSIDE EXT - MS 1180, TERRY- MS 17986, MASTODON- MS 216, NO: NAME MS 2272, CROWN. JEWEL MS 20003, DOCTOR - MS 2093. A, ESMARALDA- - MS 16165, GOLD PRINCE- - MS 20003 FEARLESS MS 17011 MUSKEGON MS 1394, RARUS  MS 1401, NANTUCKET- -MS 6954 (UND 5/12 INT IN 10.28. ACRES), DENVER - MS 1403, ALMA- MS 1708, CHARLTON- MS 1706 CLIMAX; #3- - MS 19474, TIP TOP- - MS 18108, TIP TOP #2-1 MS 19474, TIP TOP# #3-MS REPUBLIC- MS 12724, RUBY-N MS 18020, SHOSHONE - MS 17201, SILVER BOW-N MS 18020, SUNNYSIDE- MS 438, SUNNYSIDE ANNEX-1 MS 16668, THUNDERBERG-MS 1395, WEDGE-MS 18160, ANACONDA- - MS 18020, BAVARIAN MS 1396, BRIGGS- - MS 8400, BUTTE CITY - MS 18020, CLIMAX-MS 12723, CLIPPER MS 1689, HERMAN- -MS 1397, HIDDEN TREASURE EXT-1 MS 20003, LAKE - MS 2027, LAST CHANCE - MS 17901, LITTLEI MARY MS 2038, METROPOLIS -MS 1398, PEARL- - MS 5975, QUAIL - MS 20003, RAYMOND- MS 18020 GEORGE WASHINGTON- MS 2028, GRAND VIEW-MS 17202, MOUNTAIN SHEEP MS 17432, OREGON - MS 17233 HONECK-MS 16200, SILVER KING-MS 1857 PAYMASTER -MS 18080, WATERLOO-MS 17429 EMMA #1 -MS 17538, EMMA #2 - MS 17538, SMUGGLER- - MS 1758 AMA - MS 18849, BIIR HEFI.-N MS 18849, DOVER - MS 1690, GOLD PEAK - MS 16393, JOE-N MS 18849, MILANO- - MS 16393, RED MS 18849, ROCK - MS 18849, ROSA- MS 18849, ROSSO - MS 18849, ROUENA O-MS 16393, TREASURE - MS 18849, YANKEE BOY MS 18849 BEAUBREC- MS 1709 AD SEARL MS 1714, DANEBURG-MS 1780, HILDERBRAND - MS 1707, KNICKERBOCKER -MS 1717,UNDERWOOD  #47750110050002 #47750110050022 #47750130050001 #47750130050003  19474  #47750140050002 #47750150050001 #47750150050002 #47750150050011 #47750160050006  #47750220050003 #47750230050001 #47750230050002  -MS 1719  Page2of3    BLUCHER - MS 1400, EIGHTY NINE MS 16997, ESTEY- MS 13189, LIZZIEI NORRIS- MS 1702, GRAND-I MS 2573, GRANDI PRIZE- - MS 1701, GREAT! EASTERN- -MS 1691,NEW YORK - MS 8399, WELLINGTON-MS 16997, BEND PLACER - MS 11596, CHMILLSITE- MS 20594. FORMERLY PART OF SCHEDULE SUNNYSIDE GOLDCORPORATION: PERINOBOUNDARY ADJUSTMENT PARCEL C, RECORDED AS RECEPTIONI NO. 151146, IN SUSPENDED T41NI R7W. FORMERLY PART OF ANN HARRIS PLACER MS11596 AND FORMER PARCEL: BB, RECORDED AS RECEPTION! NO. 186140. FORMERLY. PART OF SCHEDULES 48290090010003 AND 48290090010036. SUNNYSIDE GOLD CORPORATION- PERINO BOUNDARY ADJUSTMENT PARCEL E, RECORDED AS RECEPTION, NO. 151146, IN SUSPENDED T41N R7W. FORMERLY PORTIONS OF MDTHATCHER MS 17699 AND POLAR STAR MILL: SITE- MS 7608. FORMERLY PART OF SCHEDULE 48290090010031 AND4 48290090010032. SUNNYSIDE GOLD CORPORATION- PERINO! BOUNDARY ADIUSTMENTPACEL F,RECORDED. AS RECEPTION NO. 151146, INS SUSPENDED T41N R7W. FORMERLY PART OF PETER PLACER - MS 11596, AND SMALL PORTIONS OF MI D THATCHER-MS 17699. AND BLM' TRACT4 41. FORMERLY PART OF SCHEDULE 48290090010031 AND BLAIR PLACER: - MS 841, GOLD -MS 14012, JEANNETTE ROUX PLACER MS 11596 MINERAL RIGHTS ONLY, RIVERSIDE (PART) MS 8801, H VI BI MILL SITE MS 20594 B. FORMERLY PART OF SCHEDULE TRACTS 42, 43, 44, 45, AND PARCEL DD! IN BUENA VISTA - MS 14012, M B MILLSITE- MS 20595 B, NJ NI MILLSITE- - MS 20595 B, TH W MS1 TRACT. A - MS 20595 B, TH WMS TRACTI B  MS 20595E B  #47750240050001 #48290090010033  SUNBEAM-MS 1419 48290090010031  #48290090010039  #48290090010041  #48290090010042  48290090010032.  #48290090010043 #48290090010044 #48290100010006  48290090010003 T41N R7W  Page3of3        7/23/24, 9:50AM  San. Juan County Mail public comment for county commissioners  Gmail  Willy Tookey <admin@sanyuancolorado.us>  public comment for county commissioners Sallie Barney salepame/@gmal.com To: Willy Tookey some-narcondousy  Tue, Jul 16, 2024 at 3:19 PM  (*Willy, if you could please forward to commissioners andi include as public comment in the next meeting, I'd much  appreciate it!) Hi Commissioners,  lam writing to put my support for the constriction on the lower river road (county road 2) in writing. After my comment, the commissioners continued the discussion raising some possible issues: -the timing ofa a constriction to allow for boater/rescue vehicles to access the river  lattended a commissioner meeting in June and made a public comment in favor of the river road constriction at that time.  -the use of a gate instead of the rocks -property owner access -community support for the idea  believe that there is wide community support for thel barrier (expressed prior to the implementation and from people who continue to text and ask me about why it's missing). It was an excellent compromise at its inception and continues to As for a gate: yes! That works! But in the meantime, please use the rocks. Let's not wait for a gate to constrict the road. As for timing to allow boaters and potential rescue vehicles: yes! Wait until the spring runoff and the OHV traffic increases- those two events work easily together. Traffic seems to pick up around the end of June when the water levels decrease As for access to private property: those property owners are familiar with the access tot their property. They know which end of the road to use to get to their property. A constriction does not mean closure and that's part of what made this Ithink it was Pete McKay who championed this ideai for the county and it had wide community support then as it does now. For the sake of the dog walkers, fishermen, bikers, runners, kids and families who use that road at a slower pace than the vehicular traffic, return the constriction at the middle of county road 2 until the end of September when traffic  serve to manage a variety of user group needs on the river road.  and the tourism increases. compromise sO effective.  quiets. All the best, Sallie Barney 1468 Bluff Street Silverton. CO 81433 Sarah "Sallie" Barney (she, her, hers) PO Box 421 Silverton, CO 81433 970-946-5363  lappreciate your service and consideration oft this request.  htps/malgoole.com/mallwo7A-faseaebleiveweplisearch-alspemmsad-mspt18047720975006557988impl-msp.1804172099150065579 1/1        7/2324,9:51AM  IMG_2693.jpg  https:llmail. qoogle.com/mallu0searc.hsallepbamne/"s40gmallcom?projector-1  1/1        7123124,9:51AM  IMG_2694.pg  DEAD END PARKING  https:!Imail. gooulecomimaluomsaarhsabamwrisomalcomPpoicorl  1/1        7/23/24, 9:51AM  MG_2695.pg  https:llmail. gpolecon'malwonseareacaslepanwrom/ocorl  1/1        7122/24,4:03PM  San. Juan County Mail- Tri-County Joint Budget Meeting  Gmail  Willy Tookey admin@sar)uancolorado.us>  Tri-County Joint Budget Meeting Mary Caldwell MCaCwele/peokong Good afternoon Mr. Tookey,  1m message  Mon, Jul 22, 2024 at 2:48 PM  To:"admin@san)uancolorado.us admnesnarcatou  lam scheduling a one-hour Tri-County Joint Budget Meeting with representatives from Archuleta, San. Juan and Lal Plata Counties to discuss the District Attorney's Office budget for 2025. The meeting will be held at the Lal Plata County Administration Building or attendees are welcome to join via Zoom. Can you please let mel know your availability as well  as the availability of the San Juan County Commissioners on the following dates:  Monday, October 7 9:30 am Tuesday, October 8 3:00 pm Weds, October 9 Thank you so much!  1:30 pm  Mary Caldwell Sr. Administrative Assistant La Plata County 1101 E2nd Avenue Durango, CO 81301 (970)382-6219  *** Please note email change mcaldwell@ipegoworg  Under the Colorado Open Records Act (CORA), all messages sent by or to me on this county-owned e-mail account may be  subject to public disclosure.  htps./mail.goole.com)mal.ork-taspaeb2eivewepiksearchealspemhnd-hvead78053137072132952806simpl-msg.t1805313707213295260 1/1        8    33 3