Agenda Joint Meeting  Madison County Board of Supervisors Wednesday, June 5, 2024 at 7:00 PM Admin. Building Auditorium, 414 North Main Street, Madison, Virginia 22727  i auion Cou  Call to Order Public Comment Public Hearings New Business  Determine Presence of a Quorum/Adoption of Agenda  1. Review proposed amendments to Appendix 1 (Zoning Ordinance), Article 14-9( (Minimum 2. Review proposed amendments to. Appendix 2 (Subdivision Ordinance), Article 7-1 (Filing 3. Review proposed amendments to. Appendix 1 (Zoning Ordinance), Article 20 (Definition- 4.1 Review proposed amendments to Appendix 1 &2( (Zoning & Subdivision Ordinances),  Off-Street Parking) - Planning & Zoning Administrator Requirements)- Planning & Zoning Administrator  Automobile Graveyard) - Planning & Zoning Administrator Boundary Line Adjustment(s) - Planning & Zoning Administrator 5. Topping Committee Funding Request - County Administrator  ntormation/Correspondence Public Comment Closed Session Adjourn    MADISON COUNTY BOARD OF SUPERVISORS MEETING  Date: Location:  7:00PM - Wednesday, June 5, 2024 Admin. Building Auditorium, 414N. Main Street  MEETING #23 - June! 5th  Ata a Joint Meeting between the Board of Supervisors and the Planning Commission on Wednesday, June 5th at 7:00PM: ini the Admin. Building Auditorium:  PRESENT:  R. Clay Jackson, Chair Carty Yowell, Vice-Chair Jud Buchanan, Member Dustin Dawson, Member James Jewett, Member  Jonathon Weakley, County Administrator Brian Gordon, Deputy County Administrator Hannon Wright, County Attorney Tracy Clatterbuck, Planning & Zoning Administrator Janet Henshaw, Planning Commission Secretary Kimberly Turner, Deputy Clerk  ABSENT:  Following the Planning Commission's: adoption of their agenda, the Board of Supervisors came to order concurrent of the Planning Commission's portion of the meeting.  CALL' TO ORDER  Chairman Jackson called the Board to order.  DETERMINE PRESENCE OF A WUORUMIADOFTION OF AGENDA  Chairman Jackson advised that a quorum was present.  Chairman Jackson stated the meeting will be a workshop between the Board of Supervisors and the Planning Commission inj preparation for the public hearings. Chairman Jackson stated the Supervisor Dawson made ai motion to approve the agenda as presented, seconded by Supervisor Jewett. Aye: Jackson, Yowell, Buchanan, Dawson, Jewett. Nay: (0). Abstain: (0). Absent: (0) The Board did not suspend their meeting. The Planning Commission went through their agenda  fifth item is regarding a Topping Committee request.  and the. Board added feedback throughout the meeting.  PUBLIC COMMENT    Chairman Jackson opened the floor forj public comment. With there being no public comment  being brought forward, thej public comment opportunity was closed.  PLANNING COMMISSION ITEMS  The Planning Commission voted on their consent agenda, which isi recorded in the Planning Commission minutes. (New. Business, item A. on the Planning Commission agenda). The Planning Commission discussed the upcoming Planning Commission dates for. June 19, 2024, which is a holiday, and. July 17,2024, which is the Madison County Fireman's) Parade.  (New Business, item B. on the Planning Commission agenda).  During the discussion, Supervisor Yowell mentioned the Planning Commission Bylaws stated that ifar meeting falls on a legal holiday, then the meeting would bei the following  business day.  The Planning Commission voted to move the meetings to June 20, 2024, and July 18, 2024 at Mr. Jim Smith, Planning Commission member, presented the proposed amendments to the Planning Commission Bylaws (Unfinished. Business, item. A. on the. Planning Commission The Planning Commission had further discussion regarding the proposed amendments to the  6:30 pm, which is recorded in the Planning Commission minutes.  agenda)  Planning Commission Bylaws. PUBLIC HEARING None.  NEW BUSINESS (Planning Commission. Listed. Items as "Unfinished. Business") 1. Review proposed amendments to Appendix 1 (Zoning Ordinance), Article 14-9 (Minimum Off-Street Parking) - Planning & Zoning Administrator Thel Planning & Zoning Administrator reviewed thej proposed amendments and request the Thel Planning Commission had further discussion regarding the proposed amendments, which is  Planning Commission take this to a public hearing on July 3, 2024.  recorded ini the Planning Commission minutes. The Board did not have any additional comments.  After discussion, it was decided that the following amendments will be considered at the public  hearing on July 3, 2024:  Article 14-9-12 (Zoning Ordinance): For officel buildings, offices, and for professionals, and personal service establishments, there shall bej provided one (I)parking space for  each two hundred (200) square feet of floor space.    Article 14-9-13 (Zoning Ordinance): For medical and dental clinics, four three (3) parking spaces per examination or treatment room, plus one parking space for each 2. Review proposed amendments to Appendix 2 (Subdivision Ordinance), Article 7-1 The Planning & Zoning Administrator stated there were very minor changes and requested the Thel Planning Commission had further discussion regarding the proposed amendments, which is  doctor and employee.  (Filing Requirements) - Planning & Zoning Administrator  Planning Commission take this to aj public hearing on July 3, 2024.  recorded: in the Planning Commission minutes. The] Board did not have any additional comments.  After discussion it was decided that the following amendments will be considered at the public  hearing on. July 3, 2024:  "An applicant shall file a minimum of17 five (5) prints ofthe final plat, prepared by a land surveyor or certified professional engineer licensed by the Commonwealth of Virginia to practice as such. An applicant shall provide an electronic copy oft the final plat. Subdivisions approved administratively shall require one print oft the final plat tol be maintained and held in County records fora ai minimum often years from the date of approval. The said surveyor or professional engineer shall affix upon each plat a signed certificate and also indicate thereon the source oft thet title ofthe owner oft the land subdivided. Any supporting data or plans shall also be filed with the Commission ori its agent. A final plat is recommended to have all required plat details and approval signatures from the Virginia Department ofHealth and Virginia Department of Transportation. Lots/parcels recorded without such approval signatures shall not be issued a zoning or building permit until such approvals are obtained in writing from said  departments."  3. Review proposed amendments to Appendix 1 (Zoning Ordinance), Article 20 Detntion-Automoble Graveyard) - Planning & Zoning Administrator  The Planning & Zoning Administrator stated under the definition ofJunk Yard it currently states, "Two hundred square feet" and then proposed changing it to say, "one hundred" to match the Thel Planning Commission had further discussion regarding the proposed amendments, which: is  definition of"Dump Heap."  recorded in the Planning Commission minutes.  During the discussion. the Board made the following comments:    Chairman Jackson clarified the new. laws regarding Farm Use tags after hearing a concern During discussion regarding enforcing the ordinance, Supervisor Jewett mentioned these amendments are: for definitions and inquired where it specifically states that they cannot  from the Planning Commission.  do it, what triggers violations, and possible remedies.  The County Attorney clarified that the only place a' "Junk Yard" is allowed isi in M21 by a special Mike Snider, Planning Commission member, stated they do not state that junk is prohibited. The Planning & Zoning Administrator stated in the Madison Code, there is a section that states,  use permit.  "if any usei is not listed by right or special use permit, it is prohibited."  Supervisor Yowell advised changing it to "one hundred square feet." Supervisor Buchanan mentioned "one hundred square feet" was very small.  After further discussion, the Board decided to change it to one hundred square feet, and it was decided that the following amended definitions will be considered at the public hearing on July  3,2024:  Article 20-13. Junkyard. The use ofa any area ofland ofmore than 100 square feet in any location for the buying or selling, storage, keeping or abandonment ofj junk including scrap metals or other scrap materials. The term "junkyard" shall include thet terms "automobile graveyard, garbage dumps, and sanitary landfills. (Ref. Va Code 8 33.2-804) Article 20-15. Automobile Graveyard. Any lot or place that is exposed to the weather and upon which more than five: inoperable motor vehicles ofany kind that are incapable of being operated and which it would not be economically practical to make operative, are Thei movement or rearrangement ofvehicles within an existing lot or facility does not render this definition inapplicable. See also junkyard and inoperable vehicle." (Ref. Va 20-102 Inoperable Vehicle. An inoperable vehicle means (i) any motor vehicle and/or trailer which isi not in operating condition; (ii) any motor vehicle which for a period of60 days or longer has been partially or totally disassembled by the removal of tires and wheels, the engine, or other essential parts required for operation of the vehicle; or (iii) any motor vehicle on which there are displayed neither valid license plates nor a valid inspection decal. Farm vehicles and tractors as defined by Va Code $ 46.2-100 and other farm machinery are exempt from this definition. (Ref. Va Code 8 15.2-904)  placed, located, or found. Code $ 33.2-804)    20-102AJ Junk. Old or scrap copper, brass, rope, rags, batteries, paper, trash, rubber, debris, or waste;, junked, dismantled, or wrecked automobiles or parts thereof,; and old or 20-121A Motor vehicle. Any vehicle as defined by Virginia Code $ 46.2-100, as amended, that is self-propelled or designed for self-propulsion. Any structure designed, used, or maintained primarily tol be loaded on or affixed to a motor vehicle to provide a mobile dwelling, sleeping place, office, or commercial space shall be considered aj part of amotor vehicle. Any device herein defined as a bicycle, electric personal assistive mobility device, electric power-assisted bicycle, motorized skateboard or scooter, moped, or personal delivery device shall be deemed not to be ai motor vehicle. (Ref. Va Code S 4. Review proposed amendments to Appendix 1 & 2 (Zoning & Subdivision Ordinances), The Planning Commission Chairman gave an overview oft the edits leading up toj present. The Planning Commission had further discussion regarding the proposed amendments, which is  scrap iron, steel, or other ferrous or nonferrous material.  46.2-100)  Boundary Line Adjustment(s) - Planning & Zoning Administrator  recorded in the Planning Commission minutes.  The Planning Commission Chairman opened the floor for public comments.  Jennifer Campbell: Ms. Jennifer Campbell suggested separating the definition from the process  with subsets for clarity.  With there being no further public comment, the public comment period closed. During the discussion. the Board made the following comments:  Chairman Jackson stated it should be one period oft time and suggested 90 days.  The. Board agreed to 90 days.  Thel Board agreed tol having one year be the limit before someone can make changes Chairman Jackson recommended that thel boundary line adjustments and vacation of  again.  boundary lines be approved administratively.  Supervisor Yowell agreed.  While discussing the zones that allow for boundary line adjustments, Supervisor Yowell stated that the size ofR1 for a boundary line adjustment (BLA) would create a  nonconforming lot for the most part.    Chairman Jackson stated they could bel buying multiple R1 lots and combine them to get onel lot. Chairman Jackson stated they have worked diligently on this boundary line adjustment in A1 and C1 and the vacation oflots. Chairman Jackson suggested going to public hearing on July 3rd and having the Planning & Zoning Administrator identify things they need to work on like R1, R2, and R3. Chairman Jackson stated they do need to start working on it and modernizing it, which is what the Planning & Zoning  Administrator is doing diligently.  There was discussion about making the word "lot" plural, and the Board agreed.  After further discussion, it was decided that the following amendments will be considered at the  public hearing on. July 3, 2024:  Subdivision Ordinance- New Proposed Definitions  2-4A. Boundary Line Adjustment (BLA). Thei relocation ofaj property line or lines between two or more existing and contiguous lots to allow a change in property size or configuration. (Ref. Va Code 15.2-2275) ABLA cannot: result ini the creation ofai new lot(s) or al lot(s) which does not conform with the: zoning ordinance, unless the original lot was already non-conforming and, in such case ofmodifying ai non-conforming lot, such lot cannot bei made smaller in area. A lot altered by this provision shall not be approved for another BLA within one year from last approval date. Any BLA shall not involve the relocation or alteration ofs streets, alleys, easements forj public passage, or other public areas and no easements or utility right-of-way shall be: relocated or altered without the express consent of all persons holding any interest therein. Al BLA application must contain a survey plat by a Commonwealth ofVirginia licensed surveyor showing current and proposed boundary lines, as well as deed restrictions, easements, rights ofway and deed dedications. The plat must show all existing septic components, including but not limited to, drainfield(s), existing well(s), existing buildings and/or structures, public utility lines, and floodplains and/or floodways on thej parcel(s). All applications must be reviewed by the Planning Commission before consideration for approval by the Board of Supervisors or its designee. All applications shall be reviewed for consideration of approval or denial by the Board of Supervisors or its designee. An approved BLA must ber recorded by Boundary Line Adjustment deed and plat in the land records ofthe Clerk's Office ofthe Circuit Court ofMadison County within 90 days of approval. Priorto recording, the deed shall be approved in writing, on its face, by the Board of Supervisors ori its designee. Al BLA cannot bei recorded unless and until itl has been approved in accordance with the provisions oft this article. (Ref. Va Code Sections 15.2-2255,15.2- 2-40. Vacation ofa boundary line. The elimination or removal ofat boundary line between two contiguous lots owned by the same owner, resulting in a single, combined lot. Thei ultimate consolidated lot must: result in a conforming lot and use consistent with the County's ordinances. Any vacation ofboundary line(s) cannot create a split-zoned parcel and must be only one: zone. Lot line vacations require the subject properties be deeded in the samei name as shown in thei tax records ofMadison County. All lot line  2258, and 15.2-2270 through 2275 as amended).    vacations require an executed deed, such as a deed ofconsolidation, affirming the lot line vacation. No easements or utility rights-of-way located along any lot lines to be vacated shall be extinguished or altered without the express consent ofall persons holding any interest therein. Prior to recording, the deed shall be approved in writing, on its face, by the Board of Supervisors ori its designee. The deed shall bei recorded: in the clerk's office by the applicant within 90 days of approval. (Ref. Va Code Sec. 15.2-2275). Subdivision Ordinance- Proposed Amendments to Definitions  2-38. Subdivision: The division.... the following shall not be defined as a subdivision: 0awwMr-ciawe .5.y4---a Meereshgedwenw-athaerdetersee gdpaN---w-wt ymnd-cwAPasashaiaw d.-e--srwwpiwawefhwmiy eelmdedadao#-fadnacawefMasiwsamy, Virginia A Boundary Line Adjustment (BLA)t to allow a change inj property size or (4) Vacation ofal boundary line(s) between two or morel lots ofrecord to produce a single The following articles would need to be modified to reconcile them with the proposed Article 3-11. Limitations of Subdivisions in Conservation, C-1 District. No lot, tract or parcel ofland ini the Conservation, C-1District shall be subdivided into more than four smaller lots, tracts or parcels of land (including the residue ifany) within any ten-year period. Except as provided above, no lot, tract or parcel ofland in the Conservation, C- 1District created by subdivision in accordance herewith shall be further subdivided within ten years from the date the subdivision plat is recorded in the Clerk's Office of the Circuit Court ofMadison County, Virginia. Aet-maetorpareeleeleflanderesteby y-d-saa.dawC4---7apis.sd X5daw--w CMd-aGaG.c. A lot, tract or parcel ofland altered by al boundary line adjustment in the Conservation, C1, District shall not be approved for another boundary line adjustment for one year from the date the plat and deed are: recorded ini the Clerk's Office ofthe Circuit Court ofl Madison County, Article 4-11. Limitations ofSubdivisions in Agricultural, A-1 Districts. No lot, tractm or parcel ofland in the Agricultural, A-1 District shall be subdivided into more than four smaller lots, tracts or parcels ofland (including the residue, ifa any) within any ten- year period. Except as provided above, no lot, tract or parcel ofland in the Agricultural,  configuration. lot.  amendments in the Zoning Ordinance:  Virginia.    A-1 District created by subdivision in accordance herewith shall be: further subdivided within ten years from the date the subdivision plat is recorded in the Clerk's Office of the Circuit Court ofl Madison County, Virginia. Py y:4-naAeiw.0--w yww5dra.lhy-thesw "ac-0H-sAdaas-Gaww Virginia- Al lot, tract or parcel ofland altered by a boundary line adjustment in the Agricultural, A1, District shall not be approved for another boundary line adjustment for one year from the date the plat and deed are: recorded in the Clerk's Office ofthe Circuit Court ofMadison County, Thei following articles would need to be modified to reconcile them with the proposed Article 4-1-5. Limitations of Subdivisions in Conservation, C-1, and Agricultural, A-1, Districts. No lot, tract or parcel ofland in the Conservation, C-1, District or Agricultural, A-1, District shall be subdivided into more than four smaller lots; tracts or parcels ofland (including the residue, ifany) within any ten-year period. Except as provided above, no lot, tract or parcel ofland ini the Conservation, C-1, or Agricultural, A-1, District created by subdivision in accordance herewith shall be further subdivided within ten years from the date the subdivision plat is recorded in the Clerk's Office of the Circuit Court ofMadison County, Virginia. ---y ynaCawArisAtBasisaalwt asds-awasi-ww-mi taaedoH-fadwacwGawA Virginia Alot, tract or parcel ofland altered by al boundary line adjustment in the Conservation, C1 or Agricultural, A1 District shall not be approved for another boundary line adjustment for one year from the date the plat and deed are: recorded in the Clerk's Chairman Jackson inquired about thet timeline for the Planning & Zoning Administrator tos start working on R1, R2, and R3. Chairman Jackson recommended the Planning & Zoning Administrator have the Planning Commission to work on this as subcommittees.  Virginia.  amendments in the Subdivision Ordinance:  Office ofthe Circuit Court ofMadison County, Virginia.  The Planning & Zoning Administrator agreed. amended ordinances, which there were not.  Thel Planning Commission Chairman inquired ift there were any public comments on the  Thel Planning Commission discussed upcoming items for future Planning Commission workshop meetings and subcommittee meetings, which is recorded in the Planning Commission minutes. (Upcoming PC Workshop Items, item. A, B, & Con the Planning Commission agenda) The Planning Commission adjourned their portion of thei meeting, which is recorded in the  PLANNING COMMISSION: ADJOURN Planning Commission minutes.    NEW BUSINESS (Continued)  5. Topping Committee Funding Request - County Administrator  Chairman Jackson stated there was a Topping Committee: meeting last week and the Animal Shelter wants to build a fence. They received three bids, and thel lowest bid was from A Quality Built Fence Company for $11,650. The Toppings Fund was donated  money to be used for the Animal Shelter.  The County Administrator gave a brief overview of thei map and the location oft thej proposed Supervisor Dawson made a motion to approve the Topping Funds for the fence: for $11,650, seconded by Supervisor Jewett. Aye: Jackson, Yowell, Buchanan, Dawson, Jewett. Nay: (0)  fence.  Abstain: (0). Absent: (0).  INFORMATION/CORRESPONDENCE  None.  PUBLIC COMMENT  Chairman Jackson opened the floor for public comment. With there being no public comment  being brought forward, the public comment opportunity was closed.  CLOSED SESSION None. ADJOURN  With there being no further business to conduct, Supervisor Jewett made ai motion to adjourn, seconded by Supervisor Dawson. Aye: Jackson, Yowell, Buchanan, Dawson, Jewett. Nay: (0)  Abstain: (0). Absent: (0)  A N  R.Clay. Jackson, Chairman  Madison County Board of Supervisors  JonathonWeakley, Clerk Adopted on: June 25,2024.    192 Son - Madison, Virginia 22727  Madison County Joint Planning Commission and Board of Supervisors  Meeting Minutes June 05, 2024  The Madison County Joint Planning Commission and Board of Supervisors meeting was held in the Madison County Administrative Auditorium at 4141 N Main Sti ini the Town of Madison, Virginia it was called to order by Chairman Carpenter at 7:01 PM. Chairman Carpenter determined there was a quorum and the first order of business was to adopt the agenda and approve the minutes Asaquorum was established the following members were present; Chairman Stephen Carpenter, Vice-Chairman Pete Elliott, Commissioners: Michael Snider, Jim Smith, James Graves III, Zach Whitman and Nathan Cowan. Also, present were Hannon Wright; County Attorney, Jonathon Weakley; County Administrator, Brian Gordon; Deputy County Administrator, Deputy Clerk; Kimberly Turner, Tracy Clatterbuck; Zoning Administrator and Janet Henshaw; Secretary for the Planning Commission. For the BoS Chairman Clay Jackson, Vice-Chairman Carty Yowell. Supervisors: Jud Buchannan, Dustin Dawson, and James Jewett were present. Chairman Carpenter suggested to amend the agenda to suspend the Planning Commission portion briefly to have the Bos come into session. Commissioner Mike Snider moved to amend, and Commissioner Nathan Cowana seconded. This motion was carried by all members saying The BoS came to order concurrent of the Planning Commission's portion of the meeting. Chairman Clay Jackson advised that the two meetings between the two boards would be in The BoS did not suspend their portion oft the meeting, the Planning Commission resumed session  from the May 15th Planning Commission Workshop meeting.  "Aye".  session together in preparation for the upcoming public hearings.  and the Bos added feedback as necessary.    Chairman Jackson asked ift there were any public comments, there were none.  1) Public Hearings: None  New Business  A. Adoption of Minutes- May 15, 2024  Commissioner Nathan Cowan moved to adopt the minutes and James Graves II seconded. This  motion was carried by all members saying "Aye".  B. Upcoming PCI Workshop Dates Discussion-  June 19, 2024 (Holiday) & July: 17, 2024 (Madison Co. Fireman's Parade)  Zoning Administrator Tracy Clatterbuck advised the board that the workshop meeting on schedule for June 19thisaf federal holiday, Juneteenth. She asked ift the meeting should bel kept or rescheduled.  Commissioner: Zack Whitman questioned ifs staff will be off. Chairman Steve Carpenter commented.yes.  During discussion Vice-Chairman Carty) Yowell mentioned that ini the bylaws ift the meetingi falls ona Commissioner Nathan Cowan motioned to move the meeting to. June 20th. Commissioner Zack Whitman  holiday, then the meeting should be rescheduled to the next business day. seconded. This motion bya all members saying "Aye", none opposed. Commissioner Mike Snider mentioned changing the advertisement.  County Administrator. Jonathon Weakley commented that the advertisement willl be changed in the Zoning Administrator Tracy Clatterbuck: also advised that the. July 17th, meeting falls on the Fireman's Parade, the road willl be closed to access to admin building and suggests rescheduling that meeting as  paper and on the website.  well to either. July: 16th or. July 18th.  Chairman: Steve Carpenter asked ifi there was any discussion?  There was none.  Commissioner Nathan Cowan made a motion for the. July 17th meeting to be moved to. July: 18+h. Commissioner. Jim Smith seconded. This motion was carried by all members saying "Aye", none opposed.  Unfinished Business  A. Review proposed amendments to the Planning Commission By-laws  Commissioner Smith presented.  Chairman Steve Carpenter mentioned that this should be ready to go toi the next WS meeting to be voted    on.  Commissioner Nathan Cowan questioned! 2-2ifCommisioner. Jim Smith had been toi the class?  Commissioner. Jim Smith stated..yes bothi in person and zoom meetings.  Zoning Administrator Tracy Clatterbuck commented that VCU is the only facility that certifies. Chairman Steve Carpenter commented should be ready for the next meeting to vote on. Not an agenda County Attorney Hannon' Wright replied..yes because it would be an official meeting of the body.  item.  There were no other comments from thel board or the public.  B. Review proposed amendments to Appendix 1 ZoningOrdinance),  Article 14-9 (Minimum Off-Street Parking). taket to the next. Joint Meeting scheduled for July 3rd.  Zoning Administrator Tracy Clatterbuck commented that shel had nothing further to add andi requested to Vice-Chairman Pete Elliott questioned..does this work fori the person that asked for the change? After discussion thet following amendments willl be presented att the. Joint meeting. July 3".  County Administrator. Jonathon' Weakley commented..yes its should.  1.) Article 14-9-12 (Zoning Ordinance): For office buildings, offices, and for professionals, andj personal service establishments, there shall bej provided one (I) parking space: for 2.) Article 14-9-13 (Zoning Ordinance): For medical and dental clinics, four three (3) parking spaces per examination or treatment room, plus one parking space for each  each two hundred (200) square feet ofi floor space.  doctor and employee.  There were no other comments from the board or thej public.  C. - Review proposed amendments to Appendix 2 (Subdivision Ordinance),  Article 7-1 (Filing Requirements)  Zoning Administrator Tracy Clatterbuck requests for the. July 3rd public hearing. Commissioner Mike! Snider questioned ife electronic copies have also been submitted? County Administrator. Jonathon Weakley replied..yes but also paper copies.  Chairman Steve Carpenter commented..we are making the ordinance match to what we have already Zoning Administrator Tracy Clatterbuck replied..surveyors typically send electronically with their  been doing.    electronic signatures.  After discussion the following amendments will be presented at the. July3"p public hearing.  "An applicant shall file ai minimum of17 five (5)prints oft the final plat, prepared bya land surveyor or certified professional engineer licensed by the Commonwealth ofVirginia toj practice as such. An applicant shall provide an electronic copy oft the final plat. Subdivisions approved administratively shall require one print ofthe final plat to be maintained andi held in County records for a minimum of ten years from the date of approval. The said surveyor or professional engineer shall affix upon each plat a signed certificate and also indicate thereon the source ofthe title oft the owner ofthel land subdivided. Any supporting data or plans shall also be filed with the Commission ori its agent. A final plati is recommended tol have all required plat details and approval signatures from the Virginia Department ofl Health and' Virginia Department of Transportation. Lots/parcels recorded without such approval signatures shall notl bei issueda zoning or building permit until such approvals are obtained in writing from said departments."  There were no other comments from the board or thej public.  D. Review proposed amendments to Appendix 1 (Zoning Ordinance), Article 20 (Definitions- Automobile Grave yard)  Zoning Administrator Tracy Clatterbuck. stated that per the definition of Junk Yard it currently states, 200 square feet, however, she is proposing to change it to 100 square feet to match the definition of trash  heapi for consistency.  Vice-Chairman Pete Elliott questioned auto graveyards for farm equipment? Commissioner Mike! Snider questioned.who makes the determiniation of a farm vehicle?  County Attorney Hannon' Wright commented..DMV. hearing concerns from the Planning Commission.  Chairman Clay Jackson clarified the new DMV farm use tag laws that will take effect. July 01, 2024, after When discussed regarding enforcing the ordinance, Board Member Jim Jewett commented that these admendments are for definitions and it specificially states that they cannot do that and what triggers County Attorney Hannon Wright mentioned that a Junk' Yard is only allowed in M2 by and SUP, otherwise.  violations and possible remedies.  itisp prohibited.  Commissioner Mike Snider stated that iti is not stated thatj junk is prohibited. that ifa use isn'tlisted by right or a SUP then iti is prohibited. Vice-Chairman Carty Yowell requested changing it to 100: square feet. Board Member. Jud Buchanan replied that 100 square feet isal bit small.  Zoning Administrator Tracy Clatterbuck commented thati int the Madison Code, therei isas section1 thatstates  Zoning Administrator Tracy Clatterbuck commented..the state code does not mention square feet.    After discussion it was decided to change it to 100 square feet and it was decided the following  admendments will be presented at the. July 3rd public hearing.  Article 20-13. Junkyard. The use of any area ofl land of more than 100 square feet in anyl location for the buying or selling, storage, keeping or abandonment ofj junk including scrap metals or other scrap materials. Thet term' "junkyard" shall include thet terms "automobile graveyard, garbage Article 20-15.. Automobile Graveyard. Any lot or place that is exposed to the weather and upon. which more than five inoperable motor vehicles of any kind that are incapable ofb being operated and which it would not be economically: practical to make operative, are placed, located, or Thei movement ori rearrangement of vehicles within an existing lot or facility does not render this definition inapplicable. See also "junkyard andi inoperable vehicle." (Ref. Va Code $33.2-804) 20-102. Inoperable Vehicle. Ani inoperable vehicle means () any motor vehicle and/ori trailer which is noti in operating condition; (ii) any motor vehicle which fora aj period of60 days or longer has been partially or totally disassembled! by the removal oft tires and wheels, the engine, or other essential parts required for operation oft the vehicle; or (in) any motor vehicle on which there are displayed neither valid license plates nor a valid inspection decal, Farm vehicles and tractors as defined by Va Code $ 46.2-100 and other farm machinery are exempt from this definition. (Ref. 20-102AJunk. Old or scrap copper, brass, rope, rags, batteries, paper, trash, rubber, debris, or waste; junked, dismantled, or wrecked automobiles or parts thereof; and old or scrapi iron, steel, 20-121A. Motor vehicle. Any vehicle as defined by Virginia Code $ 46.2-100, as amended, that is self-propelled or designed for self-propulsion. Any structure designed, used, ori maintained primarily tol bel loaded on or affixed to ai motor vehicle toj provide ai mobile dwelling, sleeping place, office, or commercial space shall be considered. aj part ofai motor vehicle. Any device herein defined as al bicycle, electric personal assistive mobility device, electric power-assisted bicycle, motorized skateboard or scooter, moped, or personal delivery device shall be deemed not  dumps, and sanitary landfills. (Ref. Va Code $ 33.2-804)  found.  Va Code $ 15.2-904)  or other ferrous or nonferrous material.  tol be a motor vehicle. (Ref. Va Code $ 46.2-100) There were no other comments from the board or the public.  E. Review proposed amendments to Appendix: 1 &2, (Zoning & Subdivision  Ordinances) Boundary Line Adjustment(s)  Chairman Steve Carpenter provided an overview of the edits leading up until the present time. Town Member. Jennifer Campbell recommended putting in points, because it was! so long, may be difficult Zoning Administrator Tracy Clatterbuck mentioned that she could have it ready by the July 3rd Public Commissioner Mike Snider recommended changing it to 90 days and to be approved administratively.  tou understand. Hearing.  Continued discussions..the BoS made the following comments:    Chairman Clay. Jackson mentioned that it should be one period of time.  It was decided to do 90 days after discussion and agreed to having one year be the limit before another Chairman Clay Jackson agreed and recommended that the BLA's and vacation of lot lines be approved After discussion thet following admendments will be presented at the. July 3rd Joint public hearing.  change canl be made. administratively.  Subdivision Ordinance- New Proposed Definitions  2-4A. Boundary Line Adjustment (BLA). The relocation of a property line or lines between two or more existing and contiguous lots to allow a change inj property size or configuration. (Ref. Va Code 15.2-2275) AE BLA cannot result in the creation ofar new lot(s) or al lot(s) which does not conform with the zoning ordinance, unless the original lot was already non-conforming and, in such case ofr modifying ai non-conforming lot, such lot cannot be made smaller in area. Al lot altered by this provision shall not be approved for another BLA within one year from last approval date. Any BLA shall not involve the relocation or alteration of streets, alleys, easements for public passage, or other public areas and no easements or utility right-of-way shall be relocated or altered without the express consent ofall persons holding anyi interest therein. Al BLA application must contain a survey plat by a Commonwealth of Virginia licensed surveyor showing current and proposed boundary lines, as well as deed restrictions, easements, rights ofway and deed dedications. The plat must show all existing septic components, including but not limited to, drainfield(s), existing well(s), existing buildings and/or structures, public utility lines, and floodplains and/or floodways on the parcel(s). --0- wtsalye-wy-wweliwpiswiw -ms-atwyea-Sieeet its-designee, An approved BLA must bei recorded by Boundary Line Adjustment deed and plat ini thel land records ofthe Clerk's Office oft the Circuit Court ofMadison County within 90 days ofapproval. Prior to recording, the deed shall be approved in writing, on its face, by the Board of Supervisors or its designee. Al BLA cannot be recorded unless and until it has been approved in accordance with the provisions oft this article. (Ref. Va Code Sections 15.2-2255, 15.2-2258, and 15.2-2270 through 2275 as amended). 2-40. Vacation ofa boundary line. The elimination or removal of a boundary line between two contiguous lots owned by the same owner, resulting in a single, combined lot. The ultimate consolidated lot must result ina a conforming lota and use consistent with the County's ordinances. Any vacation of boundary line(s) cannot create a split-zoned parcel and must be only one zone. Lot line vacations require the subject properties be deeded ini the same name as shown int the tax records of Madison County. All lot line vacations require an executed deed, such as a deed of consolidation, affirming the lot line vacation. No easements or utility rights-of-way! located along any lot lines to be vacated shall be extinguished or altered without the express consent ofall persons holding any interest therein. Prior to recording, the deed shall be approved in writing,    oni its face, by the Board of Supervisors ori its designee. The deed shall bei recorded ini the clerk's office by the applicant within 90 days of approval. (Ref. Va Code Sec. 15.2-2275). Subdivision Ordinance- Proposed Amendments to Definitions  2-38. Subdivision: The division..... thei following shall not be defined as a subdivision: hesaleorenehangeelsktaserpendefimdhtvaderadeininglandewpes egralebybowndaya4mienwiayerpeefAihatsuah saleerexehange-desmstemsemadalingleterdeesetereaiea memsenfemmingletzanépwwidmiantheriatteaswlwkmand reate-by-beundayaepusemenHa-Nn,CeFAgrearaL,A-DISHRH shal-metgain-adéiiema-éMseR-Eeyearsrem-thedelethetheplaterdedet bomndayadjusimentisesalinde-Cle.*OHweefdeChausen County, Virginia. Al Boundary Line Adjustment (BLA) to allow a change inj property (4) Vacation ofa boundary line(s) between two or more lots ofr record to produce a single lot. Thei following articles would need to be modified to reconcile them with the proposed Article 3-11. Limitations ofSubdivisions in Conservation, C-1 District. No lot, tract or parcel ofland in the Conservation, C-1District shall be subdivided into more than four smaller lots, tracts or parcels ofland (including the residue ifany) within any ten-year period. Except as provided above, no lot, tract or parcel ofland in the Conservation, C- 1[ District created by subdivision in accordance herewith shall be further subdivided within ten years from the date the subdivision plat is recorded ini the Clerk's Office of the Circuit Court of] Madison County, Virginia. Aelkptsackerpareleeflamderesieely bemdayadrusimantind-cemmaim,CiDansaalautginnadeliemaidwisien ights-until-enyearfom-thedaletheplaterdeiefboundagyaepsintis-eeerded nhe-Ciei-PlieafheChnsCameMaiseeVigha A lot, tract or parcel ofland altered by al boundary line adjustment ini the Conservation, C1,District shall not be approved for another boundary line adjustment for one year from the date the plat and deed are recorded ini the Clerk's Office ofthe Circuit Court ofl Madison County,  size or configuration.  amendments in the Zoning Ordinance:  Virginia.  Article 4-11. Limitations of Subdivisions in Agricultural, A-1 Districts. No lot, tracte or parcel of land in the Agricultural, A-1 District shall be subdivided into more than four smaller lots, tracts or parcels of land (including the residue, if any) within any ten-year period. Except as provided above, no lot, tract or parcel of land in the Agricultural, A-1 District created by subdivision in accordance herewith shall bet further subdivided within teny years from the date the    subdivision plat is recorded int the Clerk'sOffice oft the Circuit Court of Madison County, Virginia. Aysswaish-tww.wkAA ascaAwsssepwnset -w.awdd-dawsasada, Mirginia Alot, tract or parcel of land altered byal boundary! line adjustment in the Agricultural, A1, District shall not be approved fora another boundary line adjustment for one year from the date the plat and deed are recorded in the Clerk's Office of the Circuit Court of Madison County, The following articles would need to bei modified to reconcile them with the proposed Article 4-1-5. Limitations ofSubdivisions in Conservation, C-1, and. Agricultural, A-1, Districts. No lot. tract or parcel ofl land in the Conservation. C-1, District or Agricultural, A-1. District shall be subdivided into more than four smaller lots: tracts or parcels ofland (including the residue, ifany) within any ten-year period. Except as provided above, no lot, tract or parcel ofl land in the Conservation, C-1,or Agricultural, A-1, District created by subdivision in accordance herewith shall be further subdivided within ten years from the date the subdivision plati is recorded in the Clerk's Office oft the Circuit Court of! Madison County, Virginia. Alet,traet-er PeafamaesisityheymnaCamseaie-ctor AP-AtP-aaiwwsimywwn hedetetheplaterdedefhaumlayssusinsimethmwdaliaeClelksfleeef Me-CiwitCautefMadiseaum-Vgain Alot, tract or parcel ofland altered by a boundary line adjustment int the Conservation, C1 or Agricultural, Al District shall not be approved for another boundary line adjustment for one year from the date the plat and deed are recorded in the Clerk's Office oft the Circuit Court ofMadison County,  Virginia.  amendments in the Subdivision Ordinance:  Virginia.  There were no other comments from the board ort the public. Other Items from the Planning Commission, Staff, or Public  Upcoming PCWorkshop Items  A. Yates Properties of Madison LC- Site Plan Application (Review) B. Kevin and Sarah Smith- Special Use Permit Application (Introduction) Comprehensive Plan Final Draft Review (Introduction)  There being no other business, Commissioner Jim Smith made a motion to adjourn, and this was seconded by Commissioner Nathan Cowan. This motion was carried by all members saying "Aye".  The meeting ended at 8:45 PM.    4) Adjournment End of Minutes: Attest:  Ht bhk  6/20/24 Date  Stepken Carpenter, Chairman of Planning Commission OThed-euat  Janet Henshaw, Secretary of Planning Commission  00dolau Date